Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AEQ5

Protein Details
Accession A0A139AEQ5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-44ANLRQPMPEKPKEKKEKRESMLAAHydrophilic
NLS Segment(s)
PositionSequence
30-37KPKEKKEK
Subcellular Location(s) mito 15.5, cyto_mito 10, cyto 3.5, plas 3, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLSVFLVRWRFMRRVKQCDVANLRQPMPEKPKEKKEKRESMLAACFKRSSPPTNSPPIEEEPKESAVDNVDTTADLEAAAPLVKVDPFEATTTLMDGLTRLVLPCSLVVLACLVAGLSYLPTDTFIGIYPNEAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.69
4 0.66
5 0.69
6 0.7
7 0.66
8 0.64
9 0.6
10 0.55
11 0.5
12 0.5
13 0.48
14 0.48
15 0.49
16 0.48
17 0.52
18 0.62
19 0.69
20 0.77
21 0.8
22 0.82
23 0.84
24 0.8
25 0.81
26 0.74
27 0.69
28 0.68
29 0.64
30 0.54
31 0.45
32 0.42
33 0.33
34 0.35
35 0.32
36 0.29
37 0.29
38 0.36
39 0.39
40 0.47
41 0.47
42 0.44
43 0.44
44 0.42
45 0.4
46 0.33
47 0.31
48 0.25
49 0.25
50 0.24
51 0.2
52 0.17
53 0.13
54 0.13
55 0.1
56 0.08
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.07
75 0.08
76 0.08
77 0.09
78 0.09
79 0.1
80 0.1
81 0.09
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.06
109 0.07
110 0.08
111 0.08
112 0.08
113 0.11
114 0.11