Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139B028

Protein Details
Accession A0A139B028    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-44KVKGQTPKVEKQEKKKKPRGRAKKRLLYTRRFBasic
NLS Segment(s)
PositionSequence
10-37RAGKVKGQTPKVEKQEKKKKPRGRAKKR
Subcellular Location(s) mito 12, cyto_nucl 8, nucl 7.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKGQTPKVEKQEKKKKPRGRAKKRLLYTRRFVNVTLVGGKRRMNPSPQTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.41
4 0.43
5 0.48
6 0.56
7 0.6
8 0.66
9 0.65
10 0.69
11 0.74
12 0.77
13 0.81
14 0.83
15 0.83
16 0.83
17 0.89
18 0.89
19 0.89
20 0.9
21 0.9
22 0.89
23 0.87
24 0.87
25 0.84
26 0.8
27 0.74
28 0.72
29 0.66
30 0.58
31 0.52
32 0.46
33 0.41
34 0.36
35 0.35
36 0.29
37 0.26
38 0.28
39 0.3
40 0.32
41 0.36
42 0.38
43 0.39
44 0.46