Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139B0C9

Protein Details
Accession A0A139B0C9   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-38SKQPGKWKWIMIRKGRKQMLHydrophilic
NLS Segment(s)
PositionSequence
24-26KWK
31-33RKG
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015940  UBA  
IPR009060  UBA-like_sf  
Pfam View protein in Pfam  
PF00627  UBA  
PROSITE View protein in PROSITE  
PS50030  UBA  
CDD cd14309  UBA_scDdi1_like  
Amino Acid Sequences MTKKYHSWLSMNFLPKPGSKQPGKWKWIMIRKGRKQMLARLLVSRVLGSDEFARLNTVVFSIPAPAVPPLRPAAGSSTSSPPQSTVPFSGSGHRLGTSPVASPSPSINPPTGTVASTPQLSARPNPAPPPRTAFSEESISTLMALGASREEALQALQAAGGNVDIAGALLFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.42
4 0.41
5 0.43
6 0.42
7 0.5
8 0.58
9 0.65
10 0.68
11 0.65
12 0.65
13 0.65
14 0.7
15 0.71
16 0.7
17 0.71
18 0.75
19 0.81
20 0.78
21 0.76
22 0.71
23 0.71
24 0.69
25 0.64
26 0.57
27 0.49
28 0.46
29 0.4
30 0.36
31 0.27
32 0.18
33 0.14
34 0.12
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.11
41 0.09
42 0.09
43 0.08
44 0.08
45 0.06
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.07
52 0.08
53 0.09
54 0.09
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.13
61 0.15
62 0.16
63 0.16
64 0.19
65 0.2
66 0.2
67 0.19
68 0.17
69 0.16
70 0.16
71 0.15
72 0.13
73 0.13
74 0.14
75 0.15
76 0.16
77 0.16
78 0.16
79 0.15
80 0.14
81 0.12
82 0.11
83 0.12
84 0.1
85 0.1
86 0.1
87 0.1
88 0.09
89 0.1
90 0.11
91 0.13
92 0.14
93 0.15
94 0.15
95 0.15
96 0.16
97 0.19
98 0.18
99 0.16
100 0.15
101 0.15
102 0.16
103 0.15
104 0.14
105 0.11
106 0.14
107 0.15
108 0.16
109 0.2
110 0.22
111 0.24
112 0.31
113 0.38
114 0.38
115 0.39
116 0.44
117 0.41
118 0.42
119 0.45
120 0.4
121 0.35
122 0.37
123 0.35
124 0.3
125 0.28
126 0.23
127 0.18
128 0.15
129 0.12
130 0.07
131 0.07
132 0.05
133 0.05
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.05
149 0.05
150 0.04
151 0.04
152 0.03