Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AIS7

Protein Details
Accession A0A139AIS7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-41NKPSPVPKGLPKRRGRPPKTBasic
NLS Segment(s)
PositionSequence
27-40VPKGLPKRRGRPPK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, cyto 9, cyto_mito 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MDKAGDGLDNDLSDTPSTVEPNKPSPVPKGLPKRRGRPPKTSTTLISALPMSAPAPFVLFTREKRPEVKAAFPDLSFATIPATIGNMWKALSNEEKQNTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.13
5 0.15
6 0.19
7 0.21
8 0.26
9 0.29
10 0.3
11 0.31
12 0.33
13 0.37
14 0.37
15 0.42
16 0.49
17 0.55
18 0.62
19 0.68
20 0.72
21 0.76
22 0.83
23 0.8
24 0.79
25 0.76
26 0.75
27 0.73
28 0.68
29 0.59
30 0.53
31 0.48
32 0.38
33 0.33
34 0.23
35 0.17
36 0.13
37 0.12
38 0.07
39 0.05
40 0.05
41 0.04
42 0.05
43 0.05
44 0.05
45 0.09
46 0.12
47 0.13
48 0.21
49 0.26
50 0.28
51 0.31
52 0.34
53 0.38
54 0.39
55 0.43
56 0.39
57 0.4
58 0.39
59 0.36
60 0.35
61 0.27
62 0.26
63 0.19
64 0.16
65 0.11
66 0.1
67 0.1
68 0.08
69 0.09
70 0.07
71 0.09
72 0.1
73 0.09
74 0.09
75 0.12
76 0.12
77 0.15
78 0.21
79 0.24
80 0.32