Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139B096

Protein Details
Accession A0A139B096    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25VTRSCDPCRKKKCRCNNVLPQCARCHydrophilic
NLS Segment(s)
PositionSequence
38-47PKRRGPPKGS
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences VTRSCDPCRKKKCRCNNVLPQCARCDRLGLNCTYLREPKRRGPPKGSPSVVHRRLRALES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.92
5 0.9
6 0.84
7 0.75
8 0.69
9 0.62
10 0.53
11 0.42
12 0.34
13 0.26
14 0.28
15 0.28
16 0.23
17 0.24
18 0.23
19 0.25
20 0.25
21 0.29
22 0.28
23 0.33
24 0.37
25 0.42
26 0.52
27 0.59
28 0.64
29 0.66
30 0.72
31 0.73
32 0.78
33 0.73
34 0.65
35 0.65
36 0.69
37 0.69
38 0.65
39 0.59
40 0.55