Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139APB6

Protein Details
Accession A0A139APB6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
189-224TATATTPSPRQHPRRRPRRSSTSSRPSPRRPPQSPSHydrophilic
NLS Segment(s)
PositionSequence
116-120KKRRA
198-220RQHPRRRPRRSSTSSRPSPRRPP
Subcellular Location(s) nucl 10, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MWHGGPVMSPPLSLHSFTSHFPPSPSTATAPPLRTQLLSFRLLLSLVKLSTIRASTRSHSYSFDADLLYRVVESLALAVEPTPAPSGPTGTKKSTLPTTITTGTTDTAIDIASKSKKRRAKLEAHLGPAVVEAASRWDDVRMYLWKGIARVCDAWTTSGASTGGKVKVFFFFFLSSFHALCAPTPRPTTATATTPSPRQHPRRRPRRSSTSSRPSPRRPPQSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.23
5 0.29
6 0.28
7 0.26
8 0.26
9 0.28
10 0.28
11 0.3
12 0.31
13 0.29
14 0.27
15 0.32
16 0.36
17 0.35
18 0.33
19 0.33
20 0.32
21 0.29
22 0.28
23 0.29
24 0.28
25 0.27
26 0.26
27 0.23
28 0.22
29 0.22
30 0.2
31 0.15
32 0.13
33 0.11
34 0.12
35 0.11
36 0.11
37 0.14
38 0.15
39 0.15
40 0.16
41 0.19
42 0.21
43 0.28
44 0.3
45 0.29
46 0.3
47 0.31
48 0.3
49 0.28
50 0.26
51 0.19
52 0.16
53 0.16
54 0.13
55 0.11
56 0.08
57 0.07
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.05
67 0.04
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.09
74 0.12
75 0.17
76 0.21
77 0.22
78 0.24
79 0.24
80 0.27
81 0.28
82 0.27
83 0.24
84 0.22
85 0.24
86 0.23
87 0.23
88 0.21
89 0.18
90 0.16
91 0.14
92 0.12
93 0.08
94 0.06
95 0.06
96 0.05
97 0.05
98 0.07
99 0.11
100 0.16
101 0.18
102 0.26
103 0.31
104 0.34
105 0.43
106 0.48
107 0.53
108 0.57
109 0.65
110 0.62
111 0.61
112 0.57
113 0.48
114 0.41
115 0.31
116 0.23
117 0.11
118 0.07
119 0.03
120 0.05
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.08
127 0.11
128 0.12
129 0.13
130 0.14
131 0.16
132 0.16
133 0.17
134 0.18
135 0.17
136 0.16
137 0.15
138 0.15
139 0.16
140 0.15
141 0.15
142 0.15
143 0.15
144 0.12
145 0.13
146 0.12
147 0.1
148 0.11
149 0.14
150 0.16
151 0.15
152 0.15
153 0.15
154 0.18
155 0.2
156 0.19
157 0.17
158 0.17
159 0.16
160 0.18
161 0.2
162 0.19
163 0.17
164 0.17
165 0.16
166 0.15
167 0.16
168 0.2
169 0.2
170 0.23
171 0.25
172 0.26
173 0.27
174 0.29
175 0.34
176 0.31
177 0.32
178 0.3
179 0.33
180 0.34
181 0.38
182 0.38
183 0.4
184 0.47
185 0.53
186 0.62
187 0.67
188 0.76
189 0.81
190 0.89
191 0.92
192 0.92
193 0.93
194 0.91
195 0.9
196 0.9
197 0.9
198 0.9
199 0.9
200 0.89
201 0.87
202 0.89
203 0.89
204 0.89