Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A204

Protein Details
Accession A0A139A204    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
96-117CPTCRKPCPSMRSTRKDERFQGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9, cyto_nucl 9, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR043540  RING1/RING2  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0000151  C:ubiquitin ligase complex  
GO:0046872  F:metal ion binding  
GO:0035518  P:histone H2A monoubiquitination  
Pfam View protein in Pfam  
PF13923  zf-C3HC4_2  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MSSGRVWTNEHPYRPKGVEIDALGHLSAYELVRDPVAFPEEGDQRVTLPMSKLEKIFQCPICLDVMNVCVATTACLHRFCKACLSNHLFRAKEKVCPTCRKPCPSMRSTRKDERFQGIIKAVFPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.51
3 0.43
4 0.39
5 0.37
6 0.31
7 0.31
8 0.26
9 0.24
10 0.2
11 0.18
12 0.15
13 0.1
14 0.11
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.08
21 0.09
22 0.09
23 0.11
24 0.1
25 0.09
26 0.13
27 0.15
28 0.16
29 0.16
30 0.15
31 0.13
32 0.14
33 0.14
34 0.11
35 0.09
36 0.13
37 0.15
38 0.17
39 0.17
40 0.19
41 0.21
42 0.24
43 0.29
44 0.25
45 0.23
46 0.22
47 0.22
48 0.2
49 0.18
50 0.14
51 0.09
52 0.09
53 0.07
54 0.07
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.08
61 0.1
62 0.14
63 0.14
64 0.18
65 0.2
66 0.2
67 0.28
68 0.3
69 0.31
70 0.36
71 0.43
72 0.44
73 0.48
74 0.54
75 0.46
76 0.42
77 0.48
78 0.41
79 0.41
80 0.42
81 0.45
82 0.47
83 0.56
84 0.61
85 0.63
86 0.7
87 0.7
88 0.72
89 0.72
90 0.73
91 0.71
92 0.76
93 0.76
94 0.76
95 0.78
96 0.82
97 0.81
98 0.81
99 0.79
100 0.75
101 0.7
102 0.63
103 0.61
104 0.56
105 0.49