Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZPF4

Protein Details
Accession E4ZPF4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77AQSHYFRSRRVKKAKWVTTFHydrophilic
204-224HINTKRGASRRQTPCRRLALAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7, mito 5, cyto 5, cyto_mito 5, plas 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAATPDPDSIDSLPQQQHSVILRHPQSHDLNSPAGSSKGLQVSSQIGSSTSSGYQIAAQSHYFRSRRVKKAKWVTTFPILGFILGLGITGILIWDGVRTVAVHKYCEVLNENFTSWNTDIWTKEVEMDGYGNGQSDMTTDTDENIYIRDGPFVINPTLQDQSLIDQNYTLDLRSHGCTSQSWTNYVTTINATNGTIINPVKSGHINTKRGASRRQTPCRRLALARNLDAPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.25
4 0.28
5 0.28
6 0.29
7 0.27
8 0.32
9 0.35
10 0.38
11 0.4
12 0.42
13 0.43
14 0.44
15 0.45
16 0.39
17 0.37
18 0.33
19 0.33
20 0.27
21 0.23
22 0.19
23 0.16
24 0.17
25 0.18
26 0.18
27 0.17
28 0.17
29 0.19
30 0.2
31 0.19
32 0.15
33 0.12
34 0.13
35 0.13
36 0.13
37 0.1
38 0.11
39 0.1
40 0.1
41 0.11
42 0.12
43 0.13
44 0.13
45 0.14
46 0.15
47 0.18
48 0.25
49 0.25
50 0.27
51 0.37
52 0.44
53 0.53
54 0.61
55 0.65
56 0.68
57 0.79
58 0.83
59 0.79
60 0.75
61 0.7
62 0.65
63 0.6
64 0.49
65 0.42
66 0.33
67 0.26
68 0.2
69 0.15
70 0.09
71 0.07
72 0.07
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.03
85 0.03
86 0.05
87 0.09
88 0.1
89 0.11
90 0.11
91 0.12
92 0.12
93 0.14
94 0.16
95 0.13
96 0.14
97 0.15
98 0.15
99 0.14
100 0.14
101 0.15
102 0.12
103 0.12
104 0.11
105 0.11
106 0.11
107 0.12
108 0.13
109 0.1
110 0.1
111 0.1
112 0.09
113 0.08
114 0.08
115 0.06
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.04
122 0.05
123 0.06
124 0.06
125 0.07
126 0.06
127 0.07
128 0.08
129 0.08
130 0.08
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.09
139 0.11
140 0.11
141 0.11
142 0.11
143 0.14
144 0.15
145 0.14
146 0.13
147 0.11
148 0.12
149 0.15
150 0.16
151 0.13
152 0.12
153 0.12
154 0.14
155 0.14
156 0.12
157 0.09
158 0.09
159 0.12
160 0.14
161 0.16
162 0.14
163 0.15
164 0.16
165 0.21
166 0.27
167 0.26
168 0.26
169 0.26
170 0.26
171 0.25
172 0.25
173 0.2
174 0.15
175 0.15
176 0.15
177 0.14
178 0.13
179 0.14
180 0.13
181 0.13
182 0.15
183 0.13
184 0.13
185 0.13
186 0.13
187 0.15
188 0.17
189 0.2
190 0.26
191 0.35
192 0.39
193 0.4
194 0.48
195 0.52
196 0.55
197 0.6
198 0.58
199 0.59
200 0.66
201 0.75
202 0.77
203 0.77
204 0.81
205 0.8
206 0.78
207 0.74
208 0.73
209 0.73
210 0.71
211 0.67