Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139ALE2

Protein Details
Accession A0A139ALE2   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MRIRKRNTARQLKKLIRANCRKRKVSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MRIRKRNTARQLKKLIRANCRKRKVSYGTESFNAQIALTRLDYHVGTRVNHSLPIGKGEPKKAVTPPVFEMNNKLFVGYTHHEVREEEFYMDTLRWRLVDPERQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.8
4 0.82
5 0.83
6 0.83
7 0.84
8 0.81
9 0.77
10 0.78
11 0.75
12 0.73
13 0.71
14 0.67
15 0.62
16 0.57
17 0.54
18 0.45
19 0.38
20 0.29
21 0.19
22 0.14
23 0.11
24 0.11
25 0.1
26 0.1
27 0.09
28 0.1
29 0.11
30 0.09
31 0.13
32 0.13
33 0.13
34 0.15
35 0.17
36 0.17
37 0.17
38 0.17
39 0.15
40 0.13
41 0.17
42 0.16
43 0.18
44 0.2
45 0.22
46 0.25
47 0.24
48 0.27
49 0.25
50 0.31
51 0.28
52 0.29
53 0.3
54 0.33
55 0.32
56 0.3
57 0.33
58 0.28
59 0.31
60 0.27
61 0.24
62 0.18
63 0.17
64 0.23
65 0.21
66 0.24
67 0.23
68 0.24
69 0.25
70 0.26
71 0.29
72 0.26
73 0.25
74 0.21
75 0.18
76 0.18
77 0.18
78 0.18
79 0.18
80 0.15
81 0.14
82 0.14
83 0.15
84 0.2