Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A3Z8

Protein Details
Accession A0A139A3Z8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-103YWIEEPKKTRFRKKAYGDNFTHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006885  NADH_UbQ_FeS_4_mit-like  
IPR038532  NDUFS4-like_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0070469  C:respirasome  
GO:0022900  P:electron transport chain  
Pfam View protein in Pfam  
PF04800  NDUS4  
Amino Acid Sequences VVTGNAAYMRNRSVRIFSPAKTAMQSGLSGVGFWQIDFDVLDKWENPVMGWTSSADPVQALQLKFAEKEDAIAFAEKQGWEYWIEEPKKTRFRKKAYGDNFTHVPGKLRLYKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.37
4 0.34
5 0.38
6 0.38
7 0.38
8 0.35
9 0.32
10 0.25
11 0.22
12 0.21
13 0.14
14 0.14
15 0.12
16 0.11
17 0.1
18 0.11
19 0.09
20 0.09
21 0.09
22 0.06
23 0.07
24 0.07
25 0.08
26 0.06
27 0.07
28 0.08
29 0.07
30 0.09
31 0.09
32 0.09
33 0.08
34 0.09
35 0.1
36 0.1
37 0.1
38 0.1
39 0.09
40 0.1
41 0.1
42 0.08
43 0.07
44 0.07
45 0.08
46 0.11
47 0.1
48 0.1
49 0.11
50 0.12
51 0.12
52 0.13
53 0.12
54 0.08
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.1
61 0.09
62 0.11
63 0.09
64 0.1
65 0.1
66 0.1
67 0.1
68 0.12
69 0.15
70 0.21
71 0.23
72 0.24
73 0.29
74 0.36
75 0.45
76 0.51
77 0.59
78 0.6
79 0.67
80 0.75
81 0.79
82 0.82
83 0.81
84 0.83
85 0.76
86 0.72
87 0.66
88 0.58
89 0.52
90 0.42
91 0.38
92 0.31
93 0.34
94 0.37