Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A138ZYS6

Protein Details
Accession A0A138ZYS6    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-84DPPRWIPTSPSRRRRGKPSTSPLPPSSHydrophilic
NLS Segment(s)
PositionSequence
69-74RRRRGK
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MAEHVEGGHTCQPHPPGLPNGAPAKFVLEAAAPQPADSPTCPTLRISSLSPSNALRPDPPRWIPTSPSRRRRGKPSTSPLPPSSHVATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.3
5 0.31
6 0.31
7 0.34
8 0.32
9 0.31
10 0.26
11 0.24
12 0.2
13 0.18
14 0.15
15 0.09
16 0.09
17 0.09
18 0.12
19 0.09
20 0.09
21 0.1
22 0.09
23 0.1
24 0.1
25 0.14
26 0.13
27 0.14
28 0.15
29 0.15
30 0.16
31 0.16
32 0.17
33 0.14
34 0.15
35 0.17
36 0.17
37 0.18
38 0.17
39 0.19
40 0.18
41 0.18
42 0.18
43 0.2
44 0.24
45 0.29
46 0.31
47 0.32
48 0.34
49 0.36
50 0.37
51 0.43
52 0.5
53 0.54
54 0.61
55 0.67
56 0.73
57 0.77
58 0.82
59 0.82
60 0.82
61 0.82
62 0.82
63 0.83
64 0.81
65 0.82
66 0.75
67 0.71
68 0.63
69 0.58