Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139A2A3

Protein Details
Accession A0A139A2A3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-73EEKKRNHLNSEKKRRNQIRKGFBasic
NLS Segment(s)
PositionSequence
62-66EKKRR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11388  bHLH_ScINO2_like  
Amino Acid Sequences MDDARNGNGKRKRAGGSHEGNGNGNASSEESSGEEDGANSAQKSGGRFLTEEEKKRNHLNSEKKRRNQIRKGFTELVQLIPGAKESHRSESDVLTLAVKHVDNLARQKAESAARVKYLQELLARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.55
4 0.54
5 0.54
6 0.49
7 0.45
8 0.41
9 0.34
10 0.24
11 0.18
12 0.13
13 0.1
14 0.1
15 0.09
16 0.09
17 0.09
18 0.1
19 0.1
20 0.1
21 0.09
22 0.07
23 0.08
24 0.08
25 0.08
26 0.07
27 0.07
28 0.08
29 0.09
30 0.1
31 0.12
32 0.12
33 0.13
34 0.13
35 0.15
36 0.23
37 0.27
38 0.3
39 0.33
40 0.34
41 0.36
42 0.41
43 0.42
44 0.38
45 0.42
46 0.48
47 0.54
48 0.63
49 0.69
50 0.7
51 0.77
52 0.8
53 0.82
54 0.81
55 0.8
56 0.78
57 0.73
58 0.77
59 0.69
60 0.6
61 0.56
62 0.46
63 0.37
64 0.28
65 0.23
66 0.15
67 0.13
68 0.13
69 0.08
70 0.08
71 0.13
72 0.15
73 0.22
74 0.23
75 0.25
76 0.25
77 0.25
78 0.27
79 0.22
80 0.2
81 0.15
82 0.13
83 0.12
84 0.13
85 0.11
86 0.1
87 0.11
88 0.14
89 0.17
90 0.24
91 0.3
92 0.29
93 0.29
94 0.3
95 0.32
96 0.33
97 0.35
98 0.32
99 0.29
100 0.31
101 0.33
102 0.32
103 0.32
104 0.3
105 0.28