Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AC89

Protein Details
Accession A0A139AC89    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-33KCPNYCIYNKIKRHHPRQCVRTEKRNVKVSIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MLKCPNYCIYNKIKRHHPRQCVRTEKRNVKVSIEDNPNSLFPILLTLMTHAFRTGSIHHESFTQFYNTSPNGYELGTGQVEPERRPCKGWDSSRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.79
3 0.82
4 0.83
5 0.83
6 0.84
7 0.87
8 0.88
9 0.85
10 0.85
11 0.85
12 0.84
13 0.82
14 0.82
15 0.73
16 0.65
17 0.63
18 0.55
19 0.53
20 0.5
21 0.42
22 0.35
23 0.34
24 0.31
25 0.26
26 0.23
27 0.14
28 0.07
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.08
37 0.06
38 0.06
39 0.06
40 0.08
41 0.08
42 0.11
43 0.14
44 0.15
45 0.15
46 0.16
47 0.17
48 0.17
49 0.17
50 0.16
51 0.12
52 0.12
53 0.17
54 0.16
55 0.17
56 0.17
57 0.16
58 0.15
59 0.15
60 0.15
61 0.11
62 0.14
63 0.13
64 0.12
65 0.11
66 0.13
67 0.15
68 0.17
69 0.25
70 0.26
71 0.27
72 0.3
73 0.33
74 0.37
75 0.45
76 0.54