Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AG39

Protein Details
Accession A0A139AG39    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-119ELYPGYKYTPRKQKPRRCKREHNEVMSLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MVPPSDHAQAIDQSFGASALRVSSVPRPPNSFILYRREASRAIISEHLERGEAISNIKVSKLVGERWANESREVKQKYAKMALECRKKHMELYPGYKYTPRKQKPRRCKREHNEVMSLFDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.07
5 0.06
6 0.06
7 0.07
8 0.07
9 0.09
10 0.15
11 0.23
12 0.28
13 0.31
14 0.36
15 0.38
16 0.42
17 0.44
18 0.42
19 0.38
20 0.4
21 0.41
22 0.38
23 0.37
24 0.34
25 0.31
26 0.29
27 0.29
28 0.23
29 0.21
30 0.22
31 0.22
32 0.21
33 0.22
34 0.19
35 0.15
36 0.14
37 0.12
38 0.11
39 0.1
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.07
47 0.09
48 0.1
49 0.1
50 0.16
51 0.17
52 0.19
53 0.24
54 0.28
55 0.26
56 0.28
57 0.29
58 0.27
59 0.34
60 0.35
61 0.32
62 0.33
63 0.35
64 0.37
65 0.41
66 0.41
67 0.35
68 0.43
69 0.5
70 0.54
71 0.52
72 0.54
73 0.53
74 0.51
75 0.5
76 0.46
77 0.46
78 0.43
79 0.49
80 0.5
81 0.47
82 0.47
83 0.49
84 0.49
85 0.51
86 0.55
87 0.56
88 0.6
89 0.7
90 0.79
91 0.86
92 0.91
93 0.93
94 0.92
95 0.95
96 0.93
97 0.93
98 0.92
99 0.89
100 0.86
101 0.77