Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139AI38

Protein Details
Accession A0A139AI38    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-27ESADDPSQKKSKRRRTASDSSSLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002759  Pop5/Rpp14/Rnp2-like  
IPR038085  Rnp2-like_sf  
Gene Ontology GO:0030677  C:ribonuclease P complex  
GO:0004526  F:ribonuclease P activity  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01900  RNase_P_Rpp14  
Amino Acid Sequences MQPESADDPSQKKSKRRRTASDSSSLRRITLGQPEHMYILVQLVFEPPKLLTEAFYKAAVHSAVQESFGVIGSGMALDVVSFRQERGECCLRVPANHYVSLRAALTACNSSDGVACRFSILRASPFLLALSNDTQIYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.79
4 0.82
5 0.83
6 0.87
7 0.84
8 0.84
9 0.79
10 0.73
11 0.7
12 0.61
13 0.52
14 0.42
15 0.37
16 0.31
17 0.33
18 0.31
19 0.28
20 0.29
21 0.3
22 0.3
23 0.27
24 0.23
25 0.14
26 0.13
27 0.09
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.09
34 0.07
35 0.08
36 0.09
37 0.09
38 0.09
39 0.11
40 0.14
41 0.14
42 0.15
43 0.14
44 0.13
45 0.15
46 0.13
47 0.1
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.07
54 0.07
55 0.07
56 0.06
57 0.04
58 0.03
59 0.03
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.04
68 0.04
69 0.04
70 0.08
71 0.09
72 0.1
73 0.17
74 0.23
75 0.22
76 0.23
77 0.3
78 0.27
79 0.27
80 0.31
81 0.32
82 0.29
83 0.33
84 0.32
85 0.28
86 0.28
87 0.28
88 0.24
89 0.17
90 0.14
91 0.11
92 0.12
93 0.12
94 0.11
95 0.12
96 0.12
97 0.11
98 0.14
99 0.15
100 0.15
101 0.15
102 0.15
103 0.14
104 0.15
105 0.15
106 0.17
107 0.17
108 0.19
109 0.2
110 0.22
111 0.21
112 0.21
113 0.21
114 0.18
115 0.16
116 0.17
117 0.16
118 0.16