Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A567

Protein Details
Accession A0A139A567   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
310-335AAPGNAPKGRRRYKKIVPRTYRDEKGBasic
NLS Segment(s)
PositionSequence
184-215PLTKLEPKKTTAAKGKASQQAKAQGKGGAAAK
317-324KGRRRYKK
376-377KK
387-402SPPPKKGAGRGKSSGG
Subcellular Location(s) cyto 15.5, cyto_nucl 13.333, nucl 10, mito_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MADYTETLTRLINDENRIVSYHLLSKLLDVDFNTSKQMLASFESQPPIKREDFHVTFCTSGVLKNGQGIGVFLVSEDGLDDAKEKFSVFSSHVYCIAPVKPKDLEVLCAGDITPDLVRQAGKFSGITNDNITFEEKRRPAVAAPPAAPTSLQPSRSEPAQTGDPKSNGIKSMFAKAESAAPKPPLTKLEPKKTTAAKGKASQQAKAQGKGGAAAKKQSAPVADVDEDFQVGRKTKGFGKRKIEDSVSDESDESGADLQRREPVIEEDETEMEGVEIDDNAEANAPNILDTAADAPEAPTDNSLENMLFNAAPGNAPKGRRRYKKIVPRTYRDEKGYIVTTQEEVIVSESEDESPPPSRTVPTASIRPATAPKAVPKKSAPPTTEPDSPPPKKGAGRGKSSGGGTSTAKKDEKGNNSGQKSLLSFFAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.3
4 0.3
5 0.29
6 0.26
7 0.23
8 0.25
9 0.24
10 0.24
11 0.23
12 0.23
13 0.26
14 0.25
15 0.23
16 0.18
17 0.22
18 0.23
19 0.24
20 0.25
21 0.21
22 0.2
23 0.19
24 0.2
25 0.16
26 0.16
27 0.19
28 0.21
29 0.24
30 0.28
31 0.3
32 0.33
33 0.34
34 0.36
35 0.34
36 0.32
37 0.35
38 0.41
39 0.43
40 0.43
41 0.44
42 0.41
43 0.39
44 0.37
45 0.33
46 0.23
47 0.2
48 0.19
49 0.18
50 0.16
51 0.18
52 0.19
53 0.17
54 0.16
55 0.16
56 0.13
57 0.1
58 0.09
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.08
70 0.08
71 0.08
72 0.09
73 0.1
74 0.13
75 0.14
76 0.19
77 0.21
78 0.23
79 0.25
80 0.24
81 0.23
82 0.23
83 0.26
84 0.28
85 0.26
86 0.28
87 0.27
88 0.27
89 0.32
90 0.3
91 0.28
92 0.22
93 0.24
94 0.19
95 0.19
96 0.18
97 0.12
98 0.11
99 0.1
100 0.08
101 0.06
102 0.06
103 0.07
104 0.08
105 0.08
106 0.11
107 0.1
108 0.11
109 0.11
110 0.12
111 0.16
112 0.18
113 0.19
114 0.19
115 0.19
116 0.19
117 0.2
118 0.22
119 0.18
120 0.18
121 0.26
122 0.24
123 0.25
124 0.25
125 0.25
126 0.24
127 0.29
128 0.34
129 0.3
130 0.3
131 0.3
132 0.29
133 0.28
134 0.27
135 0.2
136 0.21
137 0.2
138 0.2
139 0.19
140 0.23
141 0.25
142 0.26
143 0.27
144 0.21
145 0.2
146 0.25
147 0.27
148 0.26
149 0.28
150 0.27
151 0.28
152 0.29
153 0.27
154 0.23
155 0.21
156 0.22
157 0.19
158 0.24
159 0.23
160 0.22
161 0.21
162 0.19
163 0.24
164 0.22
165 0.22
166 0.18
167 0.19
168 0.2
169 0.2
170 0.22
171 0.2
172 0.23
173 0.31
174 0.37
175 0.46
176 0.48
177 0.5
178 0.54
179 0.53
180 0.55
181 0.54
182 0.51
183 0.45
184 0.45
185 0.5
186 0.52
187 0.5
188 0.45
189 0.4
190 0.43
191 0.41
192 0.39
193 0.33
194 0.28
195 0.26
196 0.27
197 0.27
198 0.22
199 0.2
200 0.2
201 0.2
202 0.19
203 0.2
204 0.18
205 0.15
206 0.12
207 0.13
208 0.13
209 0.13
210 0.12
211 0.12
212 0.11
213 0.1
214 0.09
215 0.09
216 0.08
217 0.08
218 0.09
219 0.09
220 0.12
221 0.17
222 0.28
223 0.35
224 0.41
225 0.49
226 0.53
227 0.56
228 0.59
229 0.54
230 0.47
231 0.43
232 0.39
233 0.32
234 0.27
235 0.23
236 0.19
237 0.18
238 0.15
239 0.11
240 0.07
241 0.07
242 0.08
243 0.08
244 0.09
245 0.12
246 0.13
247 0.13
248 0.13
249 0.15
250 0.17
251 0.17
252 0.17
253 0.15
254 0.15
255 0.15
256 0.13
257 0.11
258 0.07
259 0.06
260 0.05
261 0.04
262 0.03
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.05
271 0.05
272 0.05
273 0.05
274 0.05
275 0.04
276 0.05
277 0.06
278 0.05
279 0.06
280 0.05
281 0.06
282 0.07
283 0.08
284 0.08
285 0.07
286 0.08
287 0.09
288 0.09
289 0.1
290 0.09
291 0.08
292 0.08
293 0.08
294 0.07
295 0.07
296 0.07
297 0.06
298 0.07
299 0.07
300 0.12
301 0.14
302 0.18
303 0.25
304 0.34
305 0.44
306 0.53
307 0.61
308 0.66
309 0.73
310 0.8
311 0.85
312 0.86
313 0.86
314 0.84
315 0.85
316 0.84
317 0.8
318 0.73
319 0.64
320 0.54
321 0.49
322 0.44
323 0.36
324 0.29
325 0.24
326 0.2
327 0.18
328 0.17
329 0.13
330 0.11
331 0.11
332 0.1
333 0.09
334 0.09
335 0.09
336 0.1
337 0.1
338 0.1
339 0.11
340 0.14
341 0.16
342 0.16
343 0.17
344 0.18
345 0.2
346 0.25
347 0.29
348 0.31
349 0.36
350 0.38
351 0.39
352 0.38
353 0.39
354 0.37
355 0.34
356 0.33
357 0.31
358 0.36
359 0.44
360 0.46
361 0.49
362 0.49
363 0.56
364 0.6
365 0.65
366 0.61
367 0.57
368 0.61
369 0.62
370 0.65
371 0.59
372 0.58
373 0.61
374 0.6
375 0.57
376 0.54
377 0.54
378 0.5
379 0.55
380 0.57
381 0.55
382 0.59
383 0.6
384 0.6
385 0.59
386 0.55
387 0.49
388 0.4
389 0.36
390 0.3
391 0.34
392 0.33
393 0.35
394 0.36
395 0.35
396 0.41
397 0.47
398 0.52
399 0.52
400 0.59
401 0.62
402 0.64
403 0.65
404 0.58
405 0.52
406 0.46
407 0.4
408 0.37