FuNGI

E4ZYS9

Protein Details

Accession

E4ZYS9

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
84-127	KQGSKDDKSRPLPMRRRPSQSNVPALKEPEKKVKKEPKQTGLFF	Hydrophilic

NLS Segment(s)

Position	Sequence
37-120	KKPSPAELKKLAKAEKQAKRAQAKAAGGAPNQQQGPPKEGQKLQKDSKQGSKDDKSRPLPMRRRPSQSNVPALKEPEKKVKKEP

Subcellular Location(s)

cyto_nucl 13.333, nucl 13, cyto 12.5, mito_nucl 7.333

Family & Domain DBs

InterPro	View protein in InterPro IPR000649 IF-2B-related IPR042529 IF_2B-like_C IPR037171 NagB/RpiA_transferase-like
Gene Ontology	GO:0005851 C:eukaryotic translation initiation factor 2B complex GO:0032045 C:guanyl-nucleotide exchange factor complex GO:0005085 F:guanyl-nucleotide exchange factor activity GO:0003743 F:translation initiation factor activity GO:0002183 P:cytoplasmic translational initiation GO:0043547 P:positive regulation of GTPase activity GO:0006446 P:regulation of translational initiation
Pfam	View protein in Pfam PF01008 IF-2B

Amino Acid Sequences

MPQTPTAELTPAPIAVEQQTQDGSLAATNGNATDAPKKPSPAELKKLAKAEKQAKRAQAKAAGGAPNQQQGPPKEGQKLQKDSKQGSKDDKSRPLPMRRRPSQSNVPALKEPEKKVKKEPKQTGLFFGHLYSQPKQQSLVGASKDVHPAVLALGLQYSSYAICGSTARMVAMLLVFKTVIESYQTPPGNSLARHLTSHHLGPQIEFLKSCRPLSISMGNAIRWLKDIIIKIDPSTPENEAKRDLVDEIDIFIRERVSAADRLIRDLAATKIQAGDVILTYAASSIVEQTILHAHKMGTPFSVIVVDSKPLFEGKQLARKLANQGVSVRYYLITGATHAVKDATKVFLGAHAMMSNGRLYSRVGTALVSMLASSQSLPIIVLCQSVKFTEKVALDSIVGNEVAPAEELLSEAERRELLPLKARLPSSKNDDKAGNDDLATDTTDVLRWIEDNKNLHHLQVLYDVTPAHYINMVITEYGSLPPSSVPVVHRLSTNI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.16
3	0.19
4	0.17
5	0.17
6	0.17
7	0.17
8	0.17
9	0.15
10	0.13
11	0.1
12	0.11
13	0.08
14	0.08
15	0.08
16	0.08
17	0.09
18	0.09
19	0.1
20	0.16
21	0.2
22	0.26
23	0.29
24	0.32
25	0.33
26	0.41
27	0.5
28	0.52
29	0.57
30	0.61
31	0.65
32	0.68
33	0.73
34	0.7
35	0.65
36	0.66
37	0.68
38	0.67
39	0.68
40	0.69
41	0.71
42	0.73
43	0.71
44	0.68
45	0.65
46	0.58
47	0.54
48	0.53
49	0.48
50	0.41
51	0.43
52	0.38
53	0.36
54	0.35
55	0.33
56	0.33
57	0.31
58	0.36
59	0.36
60	0.38
61	0.4
62	0.46
63	0.52
64	0.55
65	0.62
66	0.64
67	0.65
68	0.67
69	0.66
70	0.69
71	0.67
72	0.63
73	0.64
74	0.65
75	0.68
76	0.69
77	0.73
78	0.69
79	0.72
80	0.74
81	0.76
82	0.77
83	0.78
84	0.8
85	0.79
86	0.82
87	0.79
88	0.79
89	0.78
90	0.76
91	0.76
92	0.7
93	0.66
94	0.62
95	0.59
96	0.59
97	0.55
98	0.52
99	0.52
100	0.55
101	0.55
102	0.62
103	0.69
104	0.71
105	0.75
106	0.8
107	0.79
108	0.8
109	0.78
110	0.75
111	0.68
112	0.59
113	0.49
114	0.39
115	0.33
116	0.28
117	0.3
118	0.25
119	0.28
120	0.29
121	0.29
122	0.3
123	0.27
124	0.27
125	0.27
126	0.3
127	0.25
128	0.24
129	0.24
130	0.25
131	0.27
132	0.23
133	0.19
134	0.13
135	0.12
136	0.1
137	0.1
138	0.08
139	0.05
140	0.05
141	0.05
142	0.05
143	0.05
144	0.05
145	0.04
146	0.04
147	0.04
148	0.04
149	0.05
150	0.05
151	0.06
152	0.08
153	0.08
154	0.08
155	0.08
156	0.08
157	0.07
158	0.07
159	0.07
160	0.05
161	0.05
162	0.05
163	0.05
164	0.06
165	0.06
166	0.05
167	0.07
168	0.09
169	0.11
170	0.18
171	0.19
172	0.19
173	0.2
174	0.22
175	0.22
176	0.2
177	0.21
178	0.18
179	0.19
180	0.19
181	0.2
182	0.21
183	0.21
184	0.22
185	0.22
186	0.21
187	0.2
188	0.19
189	0.24
190	0.22
191	0.2
192	0.19
193	0.17
194	0.2
195	0.23
196	0.23
197	0.18
198	0.17
199	0.19
200	0.23
201	0.26
202	0.2
203	0.21
204	0.22
205	0.21
206	0.22
207	0.21
208	0.17
209	0.14
210	0.13
211	0.1
212	0.12
213	0.14
214	0.14
215	0.16
216	0.16
217	0.16
218	0.18
219	0.18
220	0.16
221	0.16
222	0.16
223	0.19
224	0.2
225	0.2
226	0.19
227	0.19
228	0.18
229	0.17
230	0.15
231	0.1
232	0.1
233	0.08
234	0.07
235	0.07
236	0.07
237	0.07
238	0.07
239	0.06
240	0.06
241	0.06
242	0.06
243	0.08
244	0.09
245	0.1
246	0.14
247	0.13
248	0.15
249	0.15
250	0.14
251	0.12
252	0.12
253	0.12
254	0.1
255	0.1
256	0.08
257	0.08
258	0.08
259	0.09
260	0.07
261	0.06
262	0.05
263	0.05
264	0.04
265	0.04
266	0.04
267	0.04
268	0.04
269	0.03
270	0.03
271	0.03
272	0.04
273	0.04
274	0.04
275	0.05
276	0.1
277	0.1
278	0.1
279	0.11
280	0.11
281	0.14
282	0.15
283	0.15
284	0.11
285	0.11
286	0.11
287	0.1
288	0.1
289	0.08
290	0.08
291	0.08
292	0.08
293	0.08
294	0.08
295	0.08
296	0.08
297	0.08
298	0.08
299	0.14
300	0.17
301	0.25
302	0.25
303	0.28
304	0.29
305	0.31
306	0.35
307	0.33
308	0.32
309	0.26
310	0.27
311	0.28
312	0.27
313	0.25
314	0.2
315	0.16
316	0.13
317	0.11
318	0.1
319	0.07
320	0.07
321	0.09
322	0.1
323	0.09
324	0.09
325	0.1
326	0.09
327	0.11
328	0.12
329	0.11
330	0.1
331	0.11
332	0.11
333	0.11
334	0.13
335	0.12
336	0.11
337	0.09
338	0.09
339	0.09
340	0.1
341	0.09
342	0.07
343	0.07
344	0.07
345	0.08
346	0.1
347	0.11
348	0.11
349	0.11
350	0.11
351	0.11
352	0.11
353	0.1
354	0.08
355	0.06
356	0.06
357	0.05
358	0.05
359	0.05
360	0.05
361	0.05
362	0.05
363	0.05
364	0.05
365	0.06
366	0.07
367	0.09
368	0.08
369	0.09
370	0.1
371	0.12
372	0.14
373	0.13
374	0.14
375	0.18
376	0.18
377	0.2
378	0.2
379	0.2
380	0.18
381	0.19
382	0.18
383	0.13
384	0.12
385	0.1
386	0.08
387	0.08
388	0.07
389	0.07
390	0.06
391	0.05
392	0.05
393	0.05
394	0.06
395	0.08
396	0.08
397	0.08
398	0.09
399	0.09
400	0.1
401	0.14
402	0.18
403	0.19
404	0.28
405	0.32
406	0.33
407	0.38
408	0.4
409	0.42
410	0.41
411	0.45
412	0.45
413	0.5
414	0.5
415	0.49
416	0.51
417	0.47
418	0.48
419	0.45
420	0.37
421	0.28
422	0.26
423	0.24
424	0.21
425	0.19
426	0.15
427	0.11
428	0.11
429	0.11
430	0.11
431	0.1
432	0.09
433	0.09
434	0.13
435	0.18
436	0.24
437	0.28
438	0.3
439	0.38
440	0.38
441	0.37
442	0.37
443	0.32
444	0.28
445	0.3
446	0.29
447	0.21
448	0.22
449	0.22
450	0.19
451	0.21
452	0.19
453	0.13
454	0.13
455	0.12
456	0.12
457	0.14
458	0.13
459	0.11
460	0.11
461	0.11
462	0.11
463	0.12
464	0.13
465	0.11
466	0.11
467	0.11
468	0.12
469	0.13
470	0.15
471	0.15
472	0.21
473	0.26
474	0.27

E4ZYS9

3D AlphaFold-predicted Structure Viewer