Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AR27

Protein Details
Accession A0A139AR27    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSLWRWCSRPCRHKNWRLYACFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, E.R. 5, golg 5, plas 4, extr 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MSLWRWCSRPCRHKNWRLYACFLFSLCFTMCVHCPACLRSHLGLCPIDFPQNHLSIRLCELSNSLNGVATLWGTVETITLEDPKEGLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.89
4 0.82
5 0.8
6 0.71
7 0.63
8 0.55
9 0.44
10 0.34
11 0.24
12 0.23
13 0.16
14 0.15
15 0.11
16 0.12
17 0.13
18 0.16
19 0.16
20 0.15
21 0.16
22 0.16
23 0.18
24 0.17
25 0.2
26 0.18
27 0.19
28 0.17
29 0.19
30 0.19
31 0.17
32 0.17
33 0.14
34 0.16
35 0.14
36 0.17
37 0.17
38 0.2
39 0.2
40 0.2
41 0.21
42 0.18
43 0.21
44 0.2
45 0.16
46 0.13
47 0.14
48 0.14
49 0.14
50 0.14
51 0.12
52 0.1
53 0.1
54 0.1
55 0.09
56 0.07
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.07
66 0.09
67 0.09
68 0.09