Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139ACV7

Protein Details
Accession A0A139ACV7   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
224-243LTTLRHQSLRPKVPRQWPLQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, cyto 4, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009030  Growth_fac_rcpt_cys_sf  
IPR011641  Tyr-kin_ephrin_A/B_rcpt-like  
Pfam View protein in Pfam  
PF07699  Ephrin_rec_like  
Amino Acid Sequences MCTTCPVGTFASTAGTGTCSDCPIGTFADMTGSIFCTWCPVVTFSSATKSTSCTSCPSGTFAASVGSVSCSACPVNTWAKVDGTGCTNCPAGGSSAVGSTTCTCSGGATFVANSNTCTCSTSDQDYVLVQGVYKCAARTTTITTQTTVTQTTTLTTSETPSSTITTSETLSTTITTSETPSTTITTSETPNTNITSSETTPETAITSATTSESATTSETATATLTTLRHQSLRPKVPRQWPLQGKSLPLWASRFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.13
6 0.12
7 0.12
8 0.12
9 0.13
10 0.13
11 0.13
12 0.12
13 0.11
14 0.1
15 0.12
16 0.12
17 0.11
18 0.11
19 0.11
20 0.11
21 0.1
22 0.1
23 0.11
24 0.12
25 0.12
26 0.13
27 0.13
28 0.14
29 0.17
30 0.19
31 0.17
32 0.22
33 0.22
34 0.22
35 0.21
36 0.22
37 0.23
38 0.22
39 0.23
40 0.22
41 0.25
42 0.26
43 0.26
44 0.27
45 0.26
46 0.24
47 0.22
48 0.18
49 0.15
50 0.12
51 0.11
52 0.08
53 0.07
54 0.08
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.1
62 0.15
63 0.18
64 0.2
65 0.2
66 0.21
67 0.22
68 0.22
69 0.19
70 0.18
71 0.16
72 0.15
73 0.15
74 0.14
75 0.13
76 0.13
77 0.12
78 0.09
79 0.09
80 0.09
81 0.07
82 0.07
83 0.08
84 0.07
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.08
95 0.06
96 0.06
97 0.07
98 0.09
99 0.09
100 0.1
101 0.1
102 0.11
103 0.11
104 0.12
105 0.11
106 0.13
107 0.15
108 0.17
109 0.16
110 0.15
111 0.16
112 0.14
113 0.14
114 0.12
115 0.09
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.08
125 0.09
126 0.15
127 0.19
128 0.24
129 0.25
130 0.25
131 0.26
132 0.26
133 0.25
134 0.2
135 0.15
136 0.11
137 0.1
138 0.1
139 0.1
140 0.09
141 0.09
142 0.08
143 0.1
144 0.1
145 0.11
146 0.11
147 0.11
148 0.12
149 0.11
150 0.11
151 0.11
152 0.11
153 0.11
154 0.11
155 0.1
156 0.1
157 0.1
158 0.1
159 0.08
160 0.08
161 0.08
162 0.08
163 0.09
164 0.1
165 0.1
166 0.11
167 0.11
168 0.12
169 0.12
170 0.12
171 0.12
172 0.13
173 0.15
174 0.17
175 0.17
176 0.18
177 0.19
178 0.2
179 0.19
180 0.17
181 0.18
182 0.19
183 0.19
184 0.19
185 0.18
186 0.18
187 0.18
188 0.17
189 0.16
190 0.11
191 0.11
192 0.09
193 0.08
194 0.08
195 0.09
196 0.09
197 0.08
198 0.09
199 0.09
200 0.09
201 0.1
202 0.1
203 0.1
204 0.11
205 0.11
206 0.1
207 0.1
208 0.09
209 0.09
210 0.11
211 0.1
212 0.12
213 0.15
214 0.17
215 0.2
216 0.23
217 0.32
218 0.4
219 0.5
220 0.56
221 0.61
222 0.68
223 0.75
224 0.81
225 0.79
226 0.79
227 0.79
228 0.74
229 0.75
230 0.69
231 0.62
232 0.56
233 0.55
234 0.47
235 0.41