Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A258

Protein Details
Accession A0A139A258    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
111-143PGSVRCRRSSWRPKASSRRRNQSLRRSRPSYSRHydrophilic
NLS Segment(s)
PositionSequence
120-137SWRPKASSRRRNQSLRRS
Subcellular Location(s) plas 11, extr 9, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSAYEVACHTGDFVSEVVFLVAGALNTACRTIVPIAVFVIYSVIYLIDLFLVCAVLVCTGVVPDAKSPPPTAPGVTVSGCRTAIRRPRDGDGSAELCGDRNGHTDRRLTHPGSVRCRRSSWRPKASSRRRNQSLRRSRPSYSRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.06
7 0.05
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.06
15 0.05
16 0.05
17 0.07
18 0.08
19 0.11
20 0.11
21 0.12
22 0.12
23 0.12
24 0.12
25 0.09
26 0.09
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.05
51 0.08
52 0.09
53 0.1
54 0.11
55 0.11
56 0.14
57 0.14
58 0.14
59 0.12
60 0.13
61 0.14
62 0.13
63 0.14
64 0.12
65 0.13
66 0.13
67 0.12
68 0.12
69 0.16
70 0.24
71 0.27
72 0.32
73 0.33
74 0.36
75 0.4
76 0.4
77 0.36
78 0.32
79 0.29
80 0.24
81 0.22
82 0.18
83 0.14
84 0.14
85 0.12
86 0.08
87 0.11
88 0.14
89 0.17
90 0.2
91 0.23
92 0.26
93 0.32
94 0.38
95 0.36
96 0.38
97 0.44
98 0.49
99 0.56
100 0.62
101 0.61
102 0.58
103 0.61
104 0.61
105 0.64
106 0.67
107 0.68
108 0.69
109 0.71
110 0.78
111 0.85
112 0.9
113 0.89
114 0.89
115 0.89
116 0.87
117 0.9
118 0.9
119 0.9
120 0.9
121 0.9
122 0.89
123 0.84
124 0.8
125 0.8