Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZI89

Protein Details
Accession E4ZI89    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-46LCSRRLCNPRMKPKSRETRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MATAHRHGTPVQRSTVSVSARSSAHALCSRRLCNPRMKPKSRETRLFFREGCTEALRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.34
4 0.29
5 0.26
6 0.24
7 0.23
8 0.23
9 0.2
10 0.14
11 0.17
12 0.2
13 0.2
14 0.22
15 0.26
16 0.27
17 0.32
18 0.36
19 0.36
20 0.41
21 0.49
22 0.56
23 0.62
24 0.68
25 0.68
26 0.74
27 0.81
28 0.8
29 0.8
30 0.75
31 0.75
32 0.74
33 0.74
34 0.64
35 0.57
36 0.53
37 0.46
38 0.43