Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139A6C1

Protein Details
Accession A0A139A6C1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-100RYCCKDCQVKDWKRHKVECSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, nucl 10, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MFPNWELAKTFVTRASIAPVFSMSLIEERTIKHFTSGQLIDAIRRGTLDGSGPWQTCRLCEKKKEEMVPRLLKCGGCAKMRYCCKDCQVKDWKRHKVECSGNKRDSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.23
4 0.21
5 0.2
6 0.18
7 0.16
8 0.15
9 0.14
10 0.09
11 0.09
12 0.09
13 0.1
14 0.1
15 0.1
16 0.14
17 0.16
18 0.16
19 0.16
20 0.18
21 0.18
22 0.23
23 0.23
24 0.2
25 0.21
26 0.21
27 0.19
28 0.19
29 0.18
30 0.11
31 0.11
32 0.1
33 0.07
34 0.08
35 0.08
36 0.06
37 0.09
38 0.11
39 0.12
40 0.12
41 0.14
42 0.13
43 0.14
44 0.2
45 0.24
46 0.27
47 0.34
48 0.4
49 0.47
50 0.53
51 0.59
52 0.6
53 0.6
54 0.64
55 0.66
56 0.6
57 0.54
58 0.5
59 0.43
60 0.37
61 0.37
62 0.33
63 0.28
64 0.3
65 0.3
66 0.37
67 0.44
68 0.5
69 0.47
70 0.47
71 0.51
72 0.58
73 0.57
74 0.58
75 0.62
76 0.63
77 0.7
78 0.75
79 0.78
80 0.77
81 0.82
82 0.77
83 0.76
84 0.79
85 0.78
86 0.78
87 0.78
88 0.77