Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A7S1

Protein Details
Accession E5A7S1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12.5, cyto_nucl 9.5, nucl 5.5, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKQTNDKLQKDVGSYRLITVATLVDRLKINGSLARKALADLEEAGQIKKVVGHSKLSIYTRAVAADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.5
15 0.41
16 0.4
17 0.35
18 0.26
19 0.25
20 0.24
21 0.28
22 0.27
23 0.27
24 0.22
25 0.22
26 0.23
27 0.24
28 0.24
29 0.22
30 0.2
31 0.19
32 0.18
33 0.17
34 0.15
35 0.12
36 0.1
37 0.08
38 0.06
39 0.08
40 0.07
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.16
50 0.16
51 0.17
52 0.16
53 0.16
54 0.16
55 0.13
56 0.12
57 0.1
58 0.11
59 0.13
60 0.13
61 0.13
62 0.12
63 0.12
64 0.11
65 0.12
66 0.15
67 0.18
68 0.2
69 0.24
70 0.26
71 0.3
72 0.35
73 0.35
74 0.35
75 0.32
76 0.31
77 0.28