Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136J6J6

Protein Details
Accession A0A136J6J6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
34-53STMLPFRKRFHPKMCPPFRWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 6, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MGASRTVIALCFWLLFIFRPGRIIVDSGLFLSSSTMLPFRKRFHPKMCPPFRWSLLQSTLGPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.12
4 0.13
5 0.12
6 0.14
7 0.14
8 0.15
9 0.15
10 0.15
11 0.11
12 0.1
13 0.1
14 0.09
15 0.09
16 0.07
17 0.07
18 0.06
19 0.06
20 0.05
21 0.05
22 0.07
23 0.08
24 0.13
25 0.17
26 0.2
27 0.3
28 0.38
29 0.45
30 0.52
31 0.62
32 0.69
33 0.76
34 0.82
35 0.78
36 0.75
37 0.76
38 0.7
39 0.66
40 0.58
41 0.54
42 0.49
43 0.48