Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136J1Z8

Protein Details
Accession A0A136J1Z8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
110-130PEQVARRAQKRERGKGKMEKKBasic
NLS Segment(s)
PositionSequence
115-130RRAQKRERGKGKMEKK
Subcellular Location(s) cyto 10.5, cyto_mito 8, nucl 6, cysk 5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MDHGLAWSASVCILLSSRGCGYQMSCDKRGPRFPETRIPLEDGVLSVQLPLLKMTPCVDLEVENLLDFKIPASITSDKGSAAPLSGAPAETLFAVPVILSEHYDDAQLLPEQVARRAQKRERGKGKMEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.12
5 0.13
6 0.13
7 0.13
8 0.14
9 0.21
10 0.3
11 0.33
12 0.35
13 0.39
14 0.44
15 0.49
16 0.56
17 0.53
18 0.52
19 0.53
20 0.55
21 0.6
22 0.61
23 0.59
24 0.53
25 0.51
26 0.43
27 0.36
28 0.32
29 0.22
30 0.17
31 0.12
32 0.1
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.08
41 0.09
42 0.1
43 0.1
44 0.11
45 0.1
46 0.1
47 0.1
48 0.11
49 0.09
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.05
59 0.09
60 0.11
61 0.13
62 0.14
63 0.15
64 0.13
65 0.14
66 0.14
67 0.1
68 0.08
69 0.07
70 0.06
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.06
87 0.07
88 0.09
89 0.09
90 0.1
91 0.09
92 0.08
93 0.1
94 0.1
95 0.09
96 0.09
97 0.12
98 0.13
99 0.15
100 0.23
101 0.25
102 0.31
103 0.4
104 0.47
105 0.54
106 0.63
107 0.71
108 0.74
109 0.77
110 0.81