Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136IIP5

Protein Details
Accession A0A136IIP5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28ALPSRNKKKTIREKNRRAATKYRNKTKCHydrophilic
NLS Segment(s)
PositionSequence
5-23RNKKKTIREKNRRAATKYR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences ALPSRNKKKTIREKNRRAATKYRNKTKCEITKLRETEKQLSKKNNILNAHVKELRDTTLVLKTEILRHGTCKDQVIHDYILRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.91
4 0.85
5 0.84
6 0.83
7 0.83
8 0.82
9 0.83
10 0.8
11 0.76
12 0.76
13 0.75
14 0.73
15 0.72
16 0.7
17 0.65
18 0.67
19 0.67
20 0.67
21 0.61
22 0.57
23 0.56
24 0.56
25 0.58
26 0.54
27 0.56
28 0.55
29 0.55
30 0.54
31 0.52
32 0.45
33 0.42
34 0.45
35 0.41
36 0.43
37 0.39
38 0.36
39 0.31
40 0.3
41 0.27
42 0.19
43 0.18
44 0.14
45 0.18
46 0.18
47 0.18
48 0.18
49 0.18
50 0.21
51 0.24
52 0.25
53 0.21
54 0.23
55 0.25
56 0.29
57 0.3
58 0.3
59 0.3
60 0.3
61 0.32
62 0.33
63 0.34
64 0.33