Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136ITT5

Protein Details
Accession A0A136ITT5    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
347-367TSNTSPDKKPVQKKIMKASSLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, cyto 5.5, cyto_mito 5, mito 3.5, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028361  GPI_transamidase  
IPR001096  Peptidase_C13  
Gene Ontology GO:0042765  C:GPI-anchor transamidase complex  
GO:0003923  F:GPI-anchor transamidase activity  
GO:0016255  P:attachment of GPI anchor to protein  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF01650  Peptidase_C13  
Amino Acid Sequences MKLSSVLQLPALLAATLLAPPSLVAAEHTSNWAVLVGTSRFWFNYRHLANVLSMYRTVKRLGIPDSQIIMMLPDDMACNPRNAFAGTVYSNADRAVDLYGDNIEVDYRGYEVTVENFIRLLTDRVGDEMPRSKRLLTDDRSNIFVYMTGHGGNEFLKFQDAEEIGAWDLADAFEQMWEKKRYHEILFMIDTCQANTMFSKLYSPNIIATGSSELDQSSYSHHADNDVGVAVIDRYTYYNLEFLENEVKDLSSKKTIGELFDSYTYEKIHSHAGTRYDLFQGGADVARSRLLTDFFGNIQNVEVDTVTNATVDDEMMKLSRTIARLKLLADEEEAAEKAGKGGAAQNTSNTSPDKKPVQKKIMKASSLSDERQWVKKLIGATAIAGCTGLWYLGSYLDSSKRTVKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.06
6 0.05
7 0.05
8 0.06
9 0.06
10 0.06
11 0.07
12 0.11
13 0.13
14 0.14
15 0.17
16 0.17
17 0.16
18 0.16
19 0.15
20 0.11
21 0.09
22 0.13
23 0.12
24 0.13
25 0.14
26 0.15
27 0.15
28 0.17
29 0.2
30 0.19
31 0.28
32 0.28
33 0.31
34 0.31
35 0.32
36 0.32
37 0.34
38 0.32
39 0.23
40 0.24
41 0.23
42 0.24
43 0.25
44 0.25
45 0.22
46 0.24
47 0.27
48 0.3
49 0.34
50 0.34
51 0.36
52 0.36
53 0.33
54 0.3
55 0.25
56 0.21
57 0.14
58 0.11
59 0.07
60 0.06
61 0.06
62 0.07
63 0.1
64 0.1
65 0.12
66 0.12
67 0.14
68 0.15
69 0.15
70 0.16
71 0.14
72 0.17
73 0.16
74 0.17
75 0.18
76 0.17
77 0.16
78 0.15
79 0.14
80 0.1
81 0.1
82 0.09
83 0.08
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.07
90 0.06
91 0.05
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.08
100 0.12
101 0.12
102 0.12
103 0.12
104 0.11
105 0.12
106 0.12
107 0.12
108 0.09
109 0.1
110 0.1
111 0.12
112 0.13
113 0.12
114 0.14
115 0.2
116 0.22
117 0.24
118 0.25
119 0.24
120 0.26
121 0.32
122 0.38
123 0.35
124 0.41
125 0.44
126 0.44
127 0.47
128 0.44
129 0.38
130 0.29
131 0.26
132 0.18
133 0.13
134 0.12
135 0.1
136 0.09
137 0.09
138 0.1
139 0.09
140 0.08
141 0.07
142 0.06
143 0.07
144 0.07
145 0.07
146 0.11
147 0.11
148 0.11
149 0.11
150 0.12
151 0.1
152 0.1
153 0.1
154 0.05
155 0.05
156 0.04
157 0.04
158 0.03
159 0.03
160 0.04
161 0.05
162 0.06
163 0.13
164 0.16
165 0.16
166 0.19
167 0.25
168 0.28
169 0.29
170 0.33
171 0.28
172 0.28
173 0.29
174 0.27
175 0.22
176 0.21
177 0.19
178 0.14
179 0.14
180 0.1
181 0.09
182 0.09
183 0.09
184 0.07
185 0.07
186 0.1
187 0.09
188 0.1
189 0.11
190 0.11
191 0.1
192 0.11
193 0.11
194 0.08
195 0.08
196 0.09
197 0.08
198 0.08
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.08
205 0.1
206 0.11
207 0.12
208 0.12
209 0.12
210 0.12
211 0.12
212 0.1
213 0.07
214 0.06
215 0.05
216 0.05
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.06
223 0.06
224 0.07
225 0.09
226 0.09
227 0.1
228 0.1
229 0.11
230 0.16
231 0.16
232 0.16
233 0.14
234 0.14
235 0.13
236 0.15
237 0.16
238 0.14
239 0.14
240 0.14
241 0.19
242 0.2
243 0.21
244 0.23
245 0.21
246 0.19
247 0.2
248 0.21
249 0.16
250 0.17
251 0.16
252 0.13
253 0.13
254 0.12
255 0.16
256 0.15
257 0.17
258 0.2
259 0.22
260 0.24
261 0.24
262 0.25
263 0.21
264 0.21
265 0.18
266 0.15
267 0.12
268 0.1
269 0.09
270 0.08
271 0.07
272 0.07
273 0.08
274 0.08
275 0.08
276 0.09
277 0.1
278 0.11
279 0.12
280 0.14
281 0.14
282 0.17
283 0.17
284 0.15
285 0.14
286 0.13
287 0.12
288 0.11
289 0.09
290 0.06
291 0.06
292 0.07
293 0.07
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.07
303 0.07
304 0.07
305 0.09
306 0.12
307 0.14
308 0.18
309 0.21
310 0.24
311 0.26
312 0.26
313 0.29
314 0.28
315 0.26
316 0.23
317 0.21
318 0.18
319 0.18
320 0.17
321 0.13
322 0.11
323 0.1
324 0.09
325 0.09
326 0.08
327 0.07
328 0.12
329 0.16
330 0.2
331 0.2
332 0.22
333 0.25
334 0.26
335 0.28
336 0.25
337 0.26
338 0.26
339 0.32
340 0.4
341 0.46
342 0.55
343 0.63
344 0.71
345 0.73
346 0.78
347 0.82
348 0.82
349 0.75
350 0.67
351 0.61
352 0.59
353 0.58
354 0.52
355 0.44
356 0.43
357 0.44
358 0.48
359 0.48
360 0.41
361 0.36
362 0.36
363 0.35
364 0.31
365 0.3
366 0.24
367 0.23
368 0.23
369 0.22
370 0.19
371 0.17
372 0.14
373 0.1
374 0.1
375 0.08
376 0.05
377 0.06
378 0.07
379 0.08
380 0.09
381 0.1
382 0.13
383 0.19
384 0.21
385 0.23