Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136IX44

Protein Details
Accession A0A136IX44   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-144PLSKNQLRKLKRQKLWEEKKADKKLIRKEKRHAKQEBasic
NLS Segment(s)
PositionSequence
115-143LRKLKRQKLWEEKKADKKLIRKEKRHAKQ
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
Amino Acid Sequences MFAAILRRGTRTIRQALAAPLHANAPLLHRGFSNVGSTSIYPRRSLTMASHNDSATAQPPAGPDAVAEANAPATEPAQSTGSKRPAEDDLDVQEDPVDNDGTATPGDAPLSKNQLRKLKRQKLWEEKKADKKLIRKEKRHAKQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.43
4 0.41
5 0.36
6 0.29
7 0.23
8 0.22
9 0.2
10 0.18
11 0.13
12 0.13
13 0.17
14 0.17
15 0.17
16 0.16
17 0.19
18 0.19
19 0.2
20 0.2
21 0.15
22 0.15
23 0.16
24 0.16
25 0.19
26 0.23
27 0.23
28 0.22
29 0.22
30 0.23
31 0.23
32 0.24
33 0.22
34 0.26
35 0.3
36 0.32
37 0.33
38 0.3
39 0.3
40 0.29
41 0.25
42 0.18
43 0.13
44 0.1
45 0.08
46 0.09
47 0.09
48 0.09
49 0.08
50 0.06
51 0.08
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.05
58 0.06
59 0.03
60 0.03
61 0.04
62 0.04
63 0.05
64 0.07
65 0.08
66 0.1
67 0.16
68 0.22
69 0.23
70 0.23
71 0.24
72 0.25
73 0.27
74 0.26
75 0.22
76 0.18
77 0.2
78 0.2
79 0.18
80 0.15
81 0.13
82 0.11
83 0.11
84 0.09
85 0.06
86 0.06
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.07
94 0.07
95 0.09
96 0.12
97 0.2
98 0.24
99 0.28
100 0.35
101 0.44
102 0.47
103 0.57
104 0.65
105 0.68
106 0.7
107 0.76
108 0.8
109 0.82
110 0.88
111 0.86
112 0.84
113 0.83
114 0.87
115 0.85
116 0.83
117 0.79
118 0.77
119 0.79
120 0.81
121 0.82
122 0.8
123 0.83
124 0.86