Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136INJ4

Protein Details
Accession A0A136INJ4    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
118-141NSEPDPPRKKSKKRSSPIVRNEAYHydrophilic
NLS Segment(s)
PositionSequence
124-131PRKKSKKR
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MPQLFSTLRSHQDNLLPPTVSLLPRIMEYNESSETLSLDSPGQWETEADELCESLGIGAPEYLLGSDQRGVHTAWGYAARLEAIYIAPRYWYSWENKHNAKEATAEELVRKIYKKYYNSEPDPPRKKSKKRSSPIVRNEAYLTLGLSQYMDPPHLVIGNVEHDKESLQNSTATNTRTAPMDCRTGDDSNFPVTTGSTKLYTIEEAVDALVSTPSLRYLVTISSSVTMPGSLWLKDKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.4
4 0.35
5 0.37
6 0.37
7 0.31
8 0.25
9 0.21
10 0.17
11 0.18
12 0.2
13 0.18
14 0.17
15 0.18
16 0.2
17 0.2
18 0.21
19 0.2
20 0.18
21 0.18
22 0.16
23 0.14
24 0.11
25 0.1
26 0.09
27 0.1
28 0.1
29 0.1
30 0.09
31 0.09
32 0.09
33 0.13
34 0.13
35 0.12
36 0.12
37 0.11
38 0.11
39 0.11
40 0.09
41 0.05
42 0.06
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.06
49 0.05
50 0.04
51 0.05
52 0.05
53 0.08
54 0.09
55 0.1
56 0.11
57 0.11
58 0.12
59 0.13
60 0.12
61 0.11
62 0.11
63 0.11
64 0.1
65 0.1
66 0.08
67 0.07
68 0.07
69 0.06
70 0.05
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.09
77 0.11
78 0.14
79 0.16
80 0.24
81 0.3
82 0.35
83 0.4
84 0.42
85 0.44
86 0.42
87 0.38
88 0.33
89 0.28
90 0.26
91 0.22
92 0.2
93 0.15
94 0.16
95 0.15
96 0.14
97 0.14
98 0.11
99 0.16
100 0.22
101 0.25
102 0.29
103 0.37
104 0.43
105 0.46
106 0.54
107 0.56
108 0.6
109 0.64
110 0.64
111 0.65
112 0.67
113 0.73
114 0.75
115 0.78
116 0.79
117 0.79
118 0.86
119 0.86
120 0.87
121 0.87
122 0.84
123 0.74
124 0.64
125 0.58
126 0.47
127 0.37
128 0.26
129 0.18
130 0.1
131 0.09
132 0.07
133 0.07
134 0.06
135 0.07
136 0.08
137 0.08
138 0.07
139 0.07
140 0.08
141 0.08
142 0.08
143 0.06
144 0.07
145 0.12
146 0.13
147 0.13
148 0.13
149 0.12
150 0.13
151 0.14
152 0.14
153 0.1
154 0.11
155 0.13
156 0.13
157 0.15
158 0.18
159 0.18
160 0.18
161 0.18
162 0.18
163 0.18
164 0.19
165 0.21
166 0.2
167 0.25
168 0.23
169 0.26
170 0.29
171 0.29
172 0.29
173 0.28
174 0.27
175 0.25
176 0.25
177 0.21
178 0.17
179 0.15
180 0.16
181 0.15
182 0.15
183 0.13
184 0.13
185 0.14
186 0.15
187 0.16
188 0.14
189 0.13
190 0.12
191 0.11
192 0.1
193 0.09
194 0.07
195 0.07
196 0.06
197 0.05
198 0.05
199 0.05
200 0.06
201 0.07
202 0.07
203 0.07
204 0.09
205 0.11
206 0.13
207 0.14
208 0.14
209 0.15
210 0.15
211 0.15
212 0.14
213 0.12
214 0.1
215 0.14
216 0.15
217 0.15