Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136INH9

Protein Details
Accession A0A136INH9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-63SCTWFWCRRARRSRVARAAPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 6, extr 6, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPVDPTLAAMGACRERVAIAGWGETVYALVIALPVLGLCLIAGSCTWFWCRRARRSRVARAAPVQLLVGGEKRIQDANQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.13
6 0.12
7 0.12
8 0.12
9 0.12
10 0.11
11 0.1
12 0.08
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.04
31 0.04
32 0.05
33 0.08
34 0.1
35 0.12
36 0.21
37 0.28
38 0.38
39 0.48
40 0.54
41 0.63
42 0.7
43 0.79
44 0.81
45 0.8
46 0.76
47 0.7
48 0.67
49 0.58
50 0.49
51 0.38
52 0.28
53 0.23
54 0.18
55 0.15
56 0.12
57 0.12
58 0.12
59 0.14
60 0.16