Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZGB1

Protein Details
Accession E4ZGB1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-98TSLNERRKWRRAACWRRKVKLARHRRPGRRTRGTGBasic
NLS Segment(s)
PositionSequence
69-98RRKWRRAACWRRKVKLARHRRPGRRTRGTG
Subcellular Location(s) mito 9, cyto 8, plas 5, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVDTRLDVHVLSGWLGVYVSLYMLVSILHQSNLLCNLERIPDVASAVKGLLSGTSVAGLMQVLTSLNERRKWRRAACWRRKVKLARHRRPGRRTRGTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.06
14 0.06
15 0.06
16 0.07
17 0.07
18 0.08
19 0.11
20 0.12
21 0.11
22 0.1
23 0.11
24 0.12
25 0.12
26 0.11
27 0.1
28 0.09
29 0.09
30 0.1
31 0.09
32 0.08
33 0.08
34 0.07
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.06
52 0.1
53 0.14
54 0.2
55 0.27
56 0.34
57 0.42
58 0.5
59 0.55
60 0.61
61 0.69
62 0.75
63 0.8
64 0.83
65 0.86
66 0.82
67 0.85
68 0.83
69 0.82
70 0.81
71 0.82
72 0.82
73 0.83
74 0.89
75 0.9
76 0.92
77 0.92
78 0.92