Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136ILA6

Protein Details
Accession A0A136ILA6   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24METLPLRKKKRRRDAPHFPNFTRLHydrophilic
NLS Segment(s)
PositionSequence
7-13RKKKRRR
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences METLPLRKKKRRRDAPHFPNFTRLPYELREAIWKLYWPEHAQTQVLFFEVTHCRAEGHHELLVCAAASMAEITRTPRTLLAVHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.94
4 0.9
5 0.8
6 0.77
7 0.67
8 0.59
9 0.52
10 0.42
11 0.35
12 0.29
13 0.32
14 0.25
15 0.25
16 0.26
17 0.23
18 0.23
19 0.2
20 0.19
21 0.17
22 0.17
23 0.19
24 0.17
25 0.17
26 0.18
27 0.18
28 0.17
29 0.16
30 0.15
31 0.12
32 0.11
33 0.09
34 0.07
35 0.1
36 0.11
37 0.13
38 0.12
39 0.12
40 0.12
41 0.13
42 0.19
43 0.19
44 0.2
45 0.2
46 0.19
47 0.19
48 0.19
49 0.19
50 0.13
51 0.09
52 0.06
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.1
60 0.13
61 0.15
62 0.16
63 0.17
64 0.2