Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A1C7

Protein Details
Accession E5A1C7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-56GNRMDDKRERKWKRLWPRARREKVLGBasic
NLS Segment(s)
PositionSequence
37-53KRERKWKRLWPRARREK
77-92KARARARARAKAKDKD
111-116KGRKGK
Subcellular Location(s) cyto 15.5, cyto_nucl 11, nucl 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MERANGGVEVSSVCMRNKEGERFYVSPGPLGNRMDDKRERKWKRLWPRARREKVLGTRAAAAGTCVAFLSHTSRLTKARARARARAKAKDKDEDKDGGAPPSSAYGEEVGKGRKGKAERAGLGEELMTTARAMVFIYLKYGLGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.23
4 0.29
5 0.34
6 0.35
7 0.37
8 0.44
9 0.44
10 0.47
11 0.46
12 0.4
13 0.34
14 0.32
15 0.31
16 0.28
17 0.27
18 0.25
19 0.26
20 0.27
21 0.33
22 0.4
23 0.42
24 0.48
25 0.58
26 0.62
27 0.62
28 0.7
29 0.74
30 0.76
31 0.82
32 0.83
33 0.82
34 0.88
35 0.91
36 0.89
37 0.84
38 0.78
39 0.76
40 0.73
41 0.68
42 0.59
43 0.49
44 0.43
45 0.38
46 0.33
47 0.24
48 0.16
49 0.1
50 0.08
51 0.06
52 0.05
53 0.04
54 0.04
55 0.05
56 0.08
57 0.09
58 0.11
59 0.12
60 0.14
61 0.16
62 0.2
63 0.23
64 0.27
65 0.33
66 0.4
67 0.44
68 0.51
69 0.57
70 0.63
71 0.65
72 0.67
73 0.67
74 0.66
75 0.66
76 0.67
77 0.62
78 0.56
79 0.53
80 0.46
81 0.4
82 0.37
83 0.34
84 0.26
85 0.24
86 0.2
87 0.16
88 0.16
89 0.15
90 0.1
91 0.1
92 0.1
93 0.09
94 0.11
95 0.13
96 0.13
97 0.17
98 0.18
99 0.18
100 0.22
101 0.25
102 0.31
103 0.37
104 0.43
105 0.42
106 0.45
107 0.46
108 0.41
109 0.38
110 0.31
111 0.23
112 0.15
113 0.13
114 0.09
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.07
121 0.09
122 0.09
123 0.11
124 0.12
125 0.12