Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136IK46

Protein Details
Accession A0A136IK46    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-35DTTALPSSTKKKKIREKNRRAATKYRNKTKCEHydrophilic
NLS Segment(s)
PositionSequence
13-29KKKKIREKNRRAATKYR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences TPSDTTALPSSTKKKKIREKNRRAATKYRNKTKCEVTKLQETEKQLSKKNSILSAHVKELRDEILALKTEILRHGTCKDQVIHGYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.78
4 0.84
5 0.87
6 0.89
7 0.9
8 0.93
9 0.92
10 0.87
11 0.86
12 0.86
13 0.85
14 0.84
15 0.84
16 0.8
17 0.75
18 0.74
19 0.73
20 0.71
21 0.68
22 0.65
23 0.59
24 0.61
25 0.59
26 0.58
27 0.52
28 0.46
29 0.42
30 0.41
31 0.4
32 0.36
33 0.37
34 0.36
35 0.36
36 0.35
37 0.36
38 0.31
39 0.32
40 0.34
41 0.34
42 0.36
43 0.37
44 0.35
45 0.31
46 0.31
47 0.27
48 0.21
49 0.18
50 0.14
51 0.13
52 0.14
53 0.14
54 0.14
55 0.14
56 0.14
57 0.16
58 0.19
59 0.16
60 0.19
61 0.22
62 0.26
63 0.28
64 0.31
65 0.31
66 0.32