Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136JHP3

Protein Details
Accession A0A136JHP3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
150-179VASSARPNPHRPRSPSPSRPKKRLSEAADLHydrophilic
NLS Segment(s)
PositionSequence
91-172KKPKTKLSLKDYKNRKEAPEETTPKPRLPALKEQEEPRRAAETTPKPEMEIKKERGTPSVASSARPNPHRPRSPSPSRPKKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEAVAKTIEETFKPILPREPHTLSPHPTLSYPPTRDPKQLEEQICRPLQYTTFVSDADRGVLLARAYFDIREEEQTSHANNTPVARPLDSKKPKTKLSLKDYKNRKEAPEETTPKPRLPALKEQEEPRRAAETTPKPEMEIKKERGTPSVASSARPNPHRPRSPSPSRPKKRLSEAADLDAKPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.34
4 0.39
5 0.42
6 0.45
7 0.47
8 0.52
9 0.56
10 0.52
11 0.53
12 0.5
13 0.44
14 0.4
15 0.37
16 0.37
17 0.39
18 0.39
19 0.41
20 0.47
21 0.49
22 0.54
23 0.55
24 0.55
25 0.56
26 0.59
27 0.56
28 0.54
29 0.54
30 0.55
31 0.52
32 0.45
33 0.37
34 0.3
35 0.27
36 0.24
37 0.23
38 0.18
39 0.18
40 0.18
41 0.18
42 0.18
43 0.17
44 0.13
45 0.11
46 0.09
47 0.08
48 0.09
49 0.08
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.1
57 0.11
58 0.13
59 0.14
60 0.14
61 0.16
62 0.17
63 0.17
64 0.17
65 0.18
66 0.16
67 0.15
68 0.16
69 0.15
70 0.17
71 0.17
72 0.16
73 0.16
74 0.19
75 0.28
76 0.34
77 0.39
78 0.43
79 0.48
80 0.51
81 0.56
82 0.62
83 0.6
84 0.62
85 0.66
86 0.63
87 0.66
88 0.72
89 0.72
90 0.7
91 0.64
92 0.58
93 0.55
94 0.54
95 0.5
96 0.51
97 0.5
98 0.46
99 0.52
100 0.52
101 0.45
102 0.43
103 0.4
104 0.36
105 0.35
106 0.42
107 0.39
108 0.44
109 0.47
110 0.52
111 0.58
112 0.55
113 0.51
114 0.43
115 0.4
116 0.33
117 0.31
118 0.35
119 0.35
120 0.38
121 0.41
122 0.39
123 0.38
124 0.44
125 0.47
126 0.45
127 0.46
128 0.45
129 0.48
130 0.53
131 0.52
132 0.49
133 0.48
134 0.41
135 0.36
136 0.4
137 0.33
138 0.3
139 0.34
140 0.38
141 0.41
142 0.44
143 0.49
144 0.5
145 0.6
146 0.67
147 0.71
148 0.73
149 0.76
150 0.82
151 0.84
152 0.85
153 0.86
154 0.87
155 0.88
156 0.87
157 0.87
158 0.86
159 0.85
160 0.81
161 0.8
162 0.75
163 0.72
164 0.71