Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136JGG3

Protein Details
Accession A0A136JGG3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-76CTGLSYKAIRQRRRQRRQDAFFGHNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, extr 6, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPASTSFSVVDADKPSNTTGFVGSSAFYFVVVGIPVIILVIACILAGCCCCCTGLSYKAIRQRRRQRRQDAFFGHNNMVGPTKHNTPPSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.16
6 0.13
7 0.12
8 0.12
9 0.11
10 0.1
11 0.09
12 0.09
13 0.08
14 0.07
15 0.06
16 0.05
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.05
39 0.07
40 0.11
41 0.15
42 0.2
43 0.22
44 0.27
45 0.35
46 0.43
47 0.49
48 0.55
49 0.63
50 0.69
51 0.77
52 0.83
53 0.86
54 0.88
55 0.88
56 0.88
57 0.84
58 0.79
59 0.74
60 0.68
61 0.58
62 0.49
63 0.42
64 0.34
65 0.3
66 0.24
67 0.21
68 0.2
69 0.25
70 0.29
71 0.34