Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136J129

Protein Details
Accession A0A136J129   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
204-229LSHGSAKGRRDRRPPRARSGNNTSSNHydrophilic
NLS Segment(s)
PositionSequence
210-221KGRRDRRPPRAR
Subcellular Location(s) nucl 22, cyto_nucl 15.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029196  HAPSTR1-like  
Pfam View protein in Pfam  
PF15251  DUF4588  
Amino Acid Sequences MDHHHVRGSSPIKQPPAADSPEQLLDAFKAAALSVTKLYKTSAAAQSKARADGYQDCLDDLLAFLDRRNLGLNDGEGWQIRKWATERLEGRDGNPQSTESEDEAERPEPISSPEIQRAQSATHLPPPQIPADPAPSTSQHPLTQQEPVIVPSQDSFTFQSAHPYPSESYLNLANLDLSDSAKSADSSINNTSTSISSGITMPSLSHGSAKGRRDRRPPRARSGNNTSSNLGRGAGTKRTINLAELFDVGSIASFGKDPFSRDGKRTRHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.49
4 0.45
5 0.39
6 0.34
7 0.33
8 0.32
9 0.32
10 0.26
11 0.2
12 0.16
13 0.15
14 0.13
15 0.1
16 0.08
17 0.07
18 0.09
19 0.09
20 0.1
21 0.13
22 0.15
23 0.15
24 0.15
25 0.17
26 0.17
27 0.19
28 0.24
29 0.29
30 0.32
31 0.35
32 0.37
33 0.42
34 0.42
35 0.42
36 0.36
37 0.28
38 0.27
39 0.3
40 0.34
41 0.32
42 0.29
43 0.27
44 0.26
45 0.26
46 0.22
47 0.15
48 0.1
49 0.08
50 0.08
51 0.08
52 0.12
53 0.12
54 0.13
55 0.15
56 0.15
57 0.14
58 0.15
59 0.16
60 0.13
61 0.14
62 0.14
63 0.12
64 0.14
65 0.13
66 0.14
67 0.14
68 0.15
69 0.16
70 0.22
71 0.24
72 0.3
73 0.33
74 0.36
75 0.42
76 0.4
77 0.4
78 0.41
79 0.39
80 0.32
81 0.3
82 0.25
83 0.19
84 0.2
85 0.21
86 0.13
87 0.14
88 0.13
89 0.13
90 0.15
91 0.14
92 0.13
93 0.11
94 0.11
95 0.09
96 0.11
97 0.12
98 0.12
99 0.14
100 0.19
101 0.2
102 0.21
103 0.21
104 0.2
105 0.18
106 0.19
107 0.2
108 0.16
109 0.2
110 0.2
111 0.2
112 0.21
113 0.22
114 0.21
115 0.18
116 0.18
117 0.13
118 0.16
119 0.16
120 0.16
121 0.16
122 0.16
123 0.17
124 0.18
125 0.19
126 0.16
127 0.18
128 0.19
129 0.18
130 0.19
131 0.17
132 0.17
133 0.15
134 0.15
135 0.15
136 0.13
137 0.12
138 0.1
139 0.12
140 0.1
141 0.12
142 0.12
143 0.11
144 0.13
145 0.12
146 0.19
147 0.18
148 0.2
149 0.18
150 0.19
151 0.18
152 0.2
153 0.21
154 0.14
155 0.15
156 0.15
157 0.15
158 0.13
159 0.13
160 0.09
161 0.08
162 0.09
163 0.07
164 0.07
165 0.06
166 0.06
167 0.07
168 0.07
169 0.07
170 0.08
171 0.1
172 0.1
173 0.14
174 0.16
175 0.17
176 0.17
177 0.18
178 0.18
179 0.15
180 0.16
181 0.13
182 0.1
183 0.09
184 0.1
185 0.1
186 0.09
187 0.08
188 0.07
189 0.09
190 0.1
191 0.09
192 0.1
193 0.11
194 0.17
195 0.23
196 0.3
197 0.37
198 0.44
199 0.51
200 0.61
201 0.7
202 0.75
203 0.8
204 0.81
205 0.83
206 0.86
207 0.85
208 0.83
209 0.82
210 0.81
211 0.77
212 0.72
213 0.64
214 0.54
215 0.49
216 0.41
217 0.32
218 0.22
219 0.19
220 0.2
221 0.24
222 0.25
223 0.25
224 0.26
225 0.3
226 0.3
227 0.29
228 0.29
229 0.25
230 0.23
231 0.22
232 0.21
233 0.16
234 0.15
235 0.12
236 0.08
237 0.07
238 0.06
239 0.05
240 0.06
241 0.06
242 0.12
243 0.13
244 0.17
245 0.23
246 0.3
247 0.35
248 0.41
249 0.51