Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136J2K7

Protein Details
Accession A0A136J2K7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-64RVLARGRRSRMGRRARPRRTAPAATTSPWRALRRRRRRHQMTHLGLGPHydrophilic
NLS Segment(s)
PositionSequence
20-77ARGRRSRMGRRARPRRTAPAATTSPWRALRRRRRRHQMTHLGLGPGRSRRRSSATSRR
Subcellular Location(s) mito 17, nucl 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MPLPPLLLLLLLMSRLRVLARGRRSRMGRRARPRRTAPAATTSPWRALRRRRRRHQMTHLGLGPGRSRRRSSATSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.11
5 0.15
6 0.22
7 0.32
8 0.41
9 0.45
10 0.52
11 0.58
12 0.63
13 0.68
14 0.71
15 0.71
16 0.74
17 0.81
18 0.81
19 0.84
20 0.81
21 0.8
22 0.76
23 0.7
24 0.61
25 0.57
26 0.5
27 0.42
28 0.4
29 0.33
30 0.3
31 0.32
32 0.33
33 0.33
34 0.41
35 0.52
36 0.59
37 0.69
38 0.75
39 0.81
40 0.87
41 0.91
42 0.92
43 0.92
44 0.87
45 0.83
46 0.75
47 0.67
48 0.57
49 0.49
50 0.43
51 0.4
52 0.4
53 0.38
54 0.39
55 0.42
56 0.49
57 0.53