Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZLW8

Protein Details
Accession E4ZLW8   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
103-123PPTSHNTKPQSQTRRHGSRRKHydrophilic
NLS Segment(s)
PositionSequence
120-123SRRK
Subcellular Location(s) cysk 13, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MQETDLHYPPERCPFCDIAAAFPFPAAPPAAESTAGPAGPPASGLWQHPRAKQELEEEAELARSIPTEQESDCEKTSPSSFVVLRSRYVVAFLDILPMTGGMPPTSHNTKPQSQTRRHGSRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.4
4 0.36
5 0.31
6 0.32
7 0.31
8 0.25
9 0.22
10 0.21
11 0.14
12 0.15
13 0.1
14 0.07
15 0.08
16 0.11
17 0.12
18 0.12
19 0.12
20 0.14
21 0.15
22 0.14
23 0.12
24 0.1
25 0.09
26 0.08
27 0.09
28 0.06
29 0.06
30 0.08
31 0.1
32 0.16
33 0.23
34 0.27
35 0.29
36 0.32
37 0.32
38 0.32
39 0.33
40 0.3
41 0.26
42 0.25
43 0.22
44 0.2
45 0.18
46 0.16
47 0.14
48 0.11
49 0.07
50 0.04
51 0.04
52 0.04
53 0.06
54 0.07
55 0.07
56 0.09
57 0.12
58 0.15
59 0.16
60 0.16
61 0.15
62 0.16
63 0.17
64 0.16
65 0.14
66 0.14
67 0.14
68 0.19
69 0.25
70 0.24
71 0.24
72 0.24
73 0.24
74 0.21
75 0.22
76 0.17
77 0.13
78 0.12
79 0.11
80 0.13
81 0.12
82 0.12
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.06
89 0.07
90 0.08
91 0.15
92 0.2
93 0.22
94 0.28
95 0.34
96 0.41
97 0.49
98 0.57
99 0.61
100 0.64
101 0.72
102 0.76
103 0.81