Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136IZ69

Protein Details
Accession A0A136IZ69    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-30RSSSKVSQYRLSRRRARRSREGLVGHydrophilic
NLS Segment(s)
PositionSequence
19-22RRAR
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKSSLRSSSKVSQYRLSRRRARRSREGLVGGLPSSLLLRMAKTMERATSFSRRPMVGDLVESVTGVYSVVNGWLDVSPLLWFVWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.72
4 0.72
5 0.75
6 0.82
7 0.84
8 0.83
9 0.83
10 0.83
11 0.8
12 0.77
13 0.7
14 0.59
15 0.51
16 0.43
17 0.32
18 0.24
19 0.17
20 0.1
21 0.07
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.07
28 0.08
29 0.09
30 0.1
31 0.11
32 0.12
33 0.14
34 0.17
35 0.24
36 0.24
37 0.26
38 0.28
39 0.27
40 0.27
41 0.27
42 0.26
43 0.2
44 0.19
45 0.17
46 0.15
47 0.15
48 0.14
49 0.11
50 0.08
51 0.07
52 0.06
53 0.04
54 0.03
55 0.03
56 0.05
57 0.05
58 0.05
59 0.07
60 0.07
61 0.08
62 0.07
63 0.08
64 0.07
65 0.08