Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136J805

Protein Details
Accession A0A136J805    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-43DASSARIKKNKKSNQSKFKVRCSKKHydrophilic
NLS Segment(s)
PositionSequence
23-31ARIKKNKKS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIADIKQFIEICRRKDASSARIKKNKKSNQSKFKVRCSKKLYTLVLKDSDKVEKLKQSLPPNLAIKEIGVQSKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.4
4 0.37
5 0.43
6 0.48
7 0.47
8 0.52
9 0.58
10 0.6
11 0.67
12 0.71
13 0.72
14 0.77
15 0.76
16 0.76
17 0.78
18 0.79
19 0.81
20 0.85
21 0.87
22 0.83
23 0.84
24 0.84
25 0.76
26 0.75
27 0.72
28 0.69
29 0.65
30 0.67
31 0.61
32 0.58
33 0.57
34 0.51
35 0.5
36 0.45
37 0.39
38 0.33
39 0.32
40 0.27
41 0.26
42 0.26
43 0.26
44 0.29
45 0.32
46 0.38
47 0.42
48 0.46
49 0.46
50 0.49
51 0.48
52 0.46
53 0.42
54 0.35
55 0.29
56 0.26
57 0.26
58 0.26
59 0.26