Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W7T1

Protein Details
Accession G0W7T1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-28SAPTKSKTKIVKTQQDQRPPTKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036786  Ribosome_mat_SBDS_N_sf  
IPR019783  SDO1/SBDS_N  
KEGG ndi:NDAI_0C01810  -  
Pfam View protein in Pfam  
PF01172  SBDS  
Amino Acid Sequences MQLPFESAPTKSKTKIVKTQQDQRPPTKYAYRGERTDFIIFVRSEDAVKQYLEKPDISDLSKVVEVFQIFVNREAKGTTGELGEASSAQLQNEFGDYKKEEEVIDLILKKGESLGPENKLRGNYRNDTRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.56
3 0.61
4 0.67
5 0.71
6 0.79
7 0.81
8 0.83
9 0.81
10 0.78
11 0.74
12 0.66
13 0.63
14 0.6
15 0.56
16 0.53
17 0.57
18 0.55
19 0.53
20 0.55
21 0.52
22 0.49
23 0.45
24 0.38
25 0.28
26 0.27
27 0.23
28 0.19
29 0.18
30 0.14
31 0.13
32 0.13
33 0.14
34 0.11
35 0.11
36 0.12
37 0.14
38 0.17
39 0.18
40 0.18
41 0.17
42 0.18
43 0.2
44 0.19
45 0.17
46 0.13
47 0.13
48 0.14
49 0.13
50 0.1
51 0.1
52 0.09
53 0.09
54 0.1
55 0.11
56 0.1
57 0.13
58 0.14
59 0.13
60 0.13
61 0.13
62 0.12
63 0.11
64 0.11
65 0.09
66 0.08
67 0.08
68 0.08
69 0.07
70 0.07
71 0.05
72 0.05
73 0.06
74 0.07
75 0.06
76 0.07
77 0.07
78 0.07
79 0.09
80 0.09
81 0.08
82 0.12
83 0.13
84 0.15
85 0.16
86 0.16
87 0.15
88 0.16
89 0.16
90 0.14
91 0.17
92 0.15
93 0.15
94 0.15
95 0.15
96 0.13
97 0.14
98 0.13
99 0.12
100 0.17
101 0.23
102 0.27
103 0.31
104 0.34
105 0.36
106 0.4
107 0.42
108 0.43
109 0.45
110 0.49