Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136J635

Protein Details
Accession A0A136J635   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
310-346GSSPSSRSSDRRTRNTNRSRRSGQSRATRQSRRSSRIHydrophilic
NLS Segment(s)
PositionSequence
256-258KEK
329-330RR
Subcellular Location(s) extr 18, plas 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKLSGSAIAGLLPLAALCISSVAAHPLDRRDGWGVSTVTWTETRTYTSTISSYYPPAYTAPAGQNCVPPPGSGQIACGPICCATWQWCQDPIKGQCLANVGQNSWTEVITTGVTTGVIVTTQFSAPYRPTSGSASTPTGTFDSATVVPTGGPQETVPADSTTSGSQLSGGAIAGIVIGTIAGLALLILCCFCCIVRGLWGAFAALFGGKKKDKERVEIIEERYSRHGSQHGGRPAHKGWFGGFGGGGRPADVASRKEKKSGGGLGWLAASAGAAALLLGLKKHDANKRRASSHKSRSDWSSSYYTDSYTGSSPSSRSSDRRTRNTNRSRRSGQSRATRQSRRSSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.04
6 0.05
7 0.05
8 0.06
9 0.09
10 0.1
11 0.12
12 0.15
13 0.18
14 0.23
15 0.23
16 0.26
17 0.26
18 0.26
19 0.25
20 0.29
21 0.26
22 0.22
23 0.25
24 0.22
25 0.2
26 0.21
27 0.2
28 0.17
29 0.17
30 0.2
31 0.19
32 0.22
33 0.21
34 0.22
35 0.21
36 0.21
37 0.22
38 0.21
39 0.22
40 0.21
41 0.2
42 0.19
43 0.19
44 0.19
45 0.18
46 0.2
47 0.24
48 0.25
49 0.28
50 0.28
51 0.32
52 0.3
53 0.32
54 0.29
55 0.22
56 0.21
57 0.21
58 0.22
59 0.18
60 0.19
61 0.19
62 0.22
63 0.22
64 0.2
65 0.17
66 0.16
67 0.16
68 0.14
69 0.12
70 0.14
71 0.21
72 0.24
73 0.26
74 0.32
75 0.34
76 0.36
77 0.43
78 0.41
79 0.4
80 0.39
81 0.36
82 0.32
83 0.33
84 0.31
85 0.27
86 0.25
87 0.21
88 0.2
89 0.2
90 0.2
91 0.17
92 0.16
93 0.11
94 0.1
95 0.11
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.05
102 0.05
103 0.04
104 0.03
105 0.03
106 0.04
107 0.05
108 0.05
109 0.06
110 0.07
111 0.08
112 0.1
113 0.12
114 0.14
115 0.14
116 0.16
117 0.18
118 0.2
119 0.2
120 0.22
121 0.21
122 0.2
123 0.19
124 0.18
125 0.16
126 0.14
127 0.12
128 0.09
129 0.1
130 0.09
131 0.1
132 0.09
133 0.08
134 0.08
135 0.08
136 0.09
137 0.06
138 0.06
139 0.06
140 0.07
141 0.07
142 0.08
143 0.09
144 0.08
145 0.08
146 0.08
147 0.1
148 0.08
149 0.08
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.04
157 0.03
158 0.03
159 0.03
160 0.03
161 0.02
162 0.02
163 0.02
164 0.01
165 0.01
166 0.01
167 0.01
168 0.01
169 0.01
170 0.01
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.03
178 0.03
179 0.04
180 0.05
181 0.06
182 0.09
183 0.11
184 0.11
185 0.12
186 0.12
187 0.11
188 0.1
189 0.09
190 0.06
191 0.05
192 0.05
193 0.05
194 0.09
195 0.11
196 0.15
197 0.18
198 0.27
199 0.29
200 0.34
201 0.4
202 0.41
203 0.46
204 0.49
205 0.49
206 0.48
207 0.45
208 0.42
209 0.39
210 0.36
211 0.3
212 0.26
213 0.25
214 0.22
215 0.28
216 0.34
217 0.38
218 0.39
219 0.4
220 0.43
221 0.42
222 0.43
223 0.38
224 0.3
225 0.24
226 0.25
227 0.24
228 0.19
229 0.17
230 0.13
231 0.13
232 0.14
233 0.13
234 0.08
235 0.08
236 0.07
237 0.1
238 0.13
239 0.15
240 0.22
241 0.31
242 0.32
243 0.36
244 0.37
245 0.37
246 0.4
247 0.43
248 0.35
249 0.32
250 0.32
251 0.28
252 0.26
253 0.24
254 0.17
255 0.11
256 0.1
257 0.04
258 0.03
259 0.02
260 0.02
261 0.02
262 0.02
263 0.03
264 0.03
265 0.04
266 0.04
267 0.06
268 0.09
269 0.16
270 0.25
271 0.33
272 0.42
273 0.52
274 0.59
275 0.65
276 0.71
277 0.73
278 0.76
279 0.78
280 0.79
281 0.73
282 0.7
283 0.69
284 0.68
285 0.61
286 0.55
287 0.5
288 0.41
289 0.42
290 0.38
291 0.33
292 0.28
293 0.26
294 0.23
295 0.19
296 0.19
297 0.15
298 0.16
299 0.16
300 0.19
301 0.23
302 0.26
303 0.31
304 0.39
305 0.47
306 0.56
307 0.64
308 0.7
309 0.75
310 0.82
311 0.87
312 0.88
313 0.87
314 0.87
315 0.85
316 0.84
317 0.84
318 0.82
319 0.8
320 0.81
321 0.82
322 0.82
323 0.85
324 0.85
325 0.82
326 0.84