Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136IN68

Protein Details
Accession A0A136IN68    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-62FQDYNPRKRRRTGRNAKESAAHydrophilic
NLS Segment(s)
PositionSequence
48-54RKRRRTG
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022159  STIP/TFIP11_N  
Pfam View protein in Pfam  
PF12457  TIP_N  
Amino Acid Sequences MSFDPASISKADAAAYSSSEDDEDSGADDFAQPSADPRDDDFQDYNPRKRRRTGRNAKESAALGIFGSDSEDDNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.1
6 0.1
7 0.1
8 0.08
9 0.08
10 0.07
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.06
21 0.08
22 0.09
23 0.09
24 0.1
25 0.14
26 0.14
27 0.17
28 0.17
29 0.17
30 0.27
31 0.31
32 0.38
33 0.43
34 0.5
35 0.51
36 0.59
37 0.66
38 0.67
39 0.74
40 0.77
41 0.79
42 0.83
43 0.84
44 0.77
45 0.71
46 0.61
47 0.51
48 0.41
49 0.3
50 0.19
51 0.15
52 0.13
53 0.08
54 0.09
55 0.07