Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136JD09

Protein Details
Accession A0A136JD09    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-31YTGKPSKSCEACRLRKKRCDKAVPGCGQCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MVYTGKPSKSCEACRLRKKRCDKAVPGCGQCRRQGTTCPGYRDLLSLSFRNETARVIGKANAQRPSSGKHDPSDGVSPSPSPSYSSKSSSSMALVSVPPTSPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.8
4 0.82
5 0.87
6 0.88
7 0.88
8 0.87
9 0.86
10 0.86
11 0.86
12 0.85
13 0.8
14 0.77
15 0.72
16 0.66
17 0.61
18 0.55
19 0.48
20 0.43
21 0.43
22 0.43
23 0.45
24 0.47
25 0.47
26 0.44
27 0.42
28 0.4
29 0.35
30 0.28
31 0.23
32 0.2
33 0.17
34 0.16
35 0.16
36 0.15
37 0.16
38 0.15
39 0.11
40 0.11
41 0.13
42 0.13
43 0.13
44 0.15
45 0.19
46 0.23
47 0.28
48 0.31
49 0.29
50 0.29
51 0.3
52 0.32
53 0.33
54 0.34
55 0.32
56 0.28
57 0.31
58 0.3
59 0.32
60 0.32
61 0.28
62 0.23
63 0.21
64 0.2
65 0.19
66 0.2
67 0.17
68 0.16
69 0.17
70 0.22
71 0.25
72 0.28
73 0.3
74 0.31
75 0.32
76 0.3
77 0.29
78 0.24
79 0.2
80 0.18
81 0.16
82 0.14
83 0.14