Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A136J699

Protein Details
Accession A0A136J699    Localization Confidence High Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
326-349QVDKAIERKRKKVVAKERRDMPWAHydrophilic
NLS Segment(s)
PositionSequence
10-10K
152-165KNRRAPIPSRAHKH
238-248PGATKRNKKLK
272-312KASQAAKDKHRELLDEHRKKEKELVKQGKTPFYLKKAEQKK
320-345AGMKKGQVDKAIERKRKKVVAKERRD
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MQRTNPGKRKAPLGGTLNRRVRARKEEPEPEQFYDDSQSDGASDDEAPMEMSSSKKSKHRQAQSGSESDDIGSQDEDDEGDDDDDNEASEDESDAGPSLAAARVSFGALAKAQASLPSTRKKKGGAKDEPSNDDSDSEDSADGRRTKDDPSKNRRAPIPSRAHKHAPTEQTSKRAVTRKREVIPQTIVKARDPRFDPTAGEVDSDRFRRAYGFLDSYRDDELAVMKRTLRDATAAAKPGATKRNKKLKDAPILSEHERENLKREIASIESRKASQAAKDKHRELLDEHRKKEKELVKQGKTPFYLKKAEQKKQVLVDRFAGMKKGQVDKAIERKRKKVVAKERRDMPWARRTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.7
4 0.69
5 0.67
6 0.66
7 0.63
8 0.63
9 0.65
10 0.65
11 0.65
12 0.67
13 0.72
14 0.74
15 0.78
16 0.76
17 0.69
18 0.63
19 0.54
20 0.46
21 0.4
22 0.34
23 0.26
24 0.2
25 0.16
26 0.13
27 0.14
28 0.13
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.09
35 0.08
36 0.08
37 0.09
38 0.1
39 0.14
40 0.18
41 0.23
42 0.3
43 0.39
44 0.48
45 0.57
46 0.66
47 0.7
48 0.74
49 0.8
50 0.78
51 0.74
52 0.66
53 0.57
54 0.47
55 0.38
56 0.32
57 0.22
58 0.16
59 0.12
60 0.09
61 0.09
62 0.09
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.08
93 0.07
94 0.07
95 0.07
96 0.08
97 0.07
98 0.08
99 0.08
100 0.09
101 0.1
102 0.13
103 0.18
104 0.26
105 0.31
106 0.33
107 0.36
108 0.41
109 0.47
110 0.52
111 0.58
112 0.59
113 0.61
114 0.67
115 0.68
116 0.66
117 0.6
118 0.53
119 0.42
120 0.33
121 0.27
122 0.2
123 0.16
124 0.12
125 0.1
126 0.09
127 0.1
128 0.14
129 0.14
130 0.14
131 0.15
132 0.16
133 0.21
134 0.29
135 0.37
136 0.43
137 0.51
138 0.61
139 0.62
140 0.65
141 0.65
142 0.63
143 0.6
144 0.6
145 0.61
146 0.57
147 0.59
148 0.6
149 0.61
150 0.57
151 0.57
152 0.53
153 0.48
154 0.46
155 0.48
156 0.45
157 0.44
158 0.43
159 0.39
160 0.38
161 0.4
162 0.4
163 0.41
164 0.47
165 0.5
166 0.51
167 0.57
168 0.54
169 0.51
170 0.51
171 0.45
172 0.39
173 0.36
174 0.34
175 0.3
176 0.35
177 0.31
178 0.33
179 0.32
180 0.33
181 0.32
182 0.32
183 0.3
184 0.26
185 0.27
186 0.21
187 0.19
188 0.16
189 0.15
190 0.17
191 0.18
192 0.16
193 0.13
194 0.13
195 0.13
196 0.14
197 0.15
198 0.16
199 0.19
200 0.19
201 0.22
202 0.23
203 0.24
204 0.23
205 0.2
206 0.16
207 0.12
208 0.14
209 0.15
210 0.16
211 0.15
212 0.15
213 0.16
214 0.18
215 0.18
216 0.15
217 0.12
218 0.12
219 0.16
220 0.19
221 0.2
222 0.19
223 0.19
224 0.19
225 0.23
226 0.3
227 0.34
228 0.38
229 0.46
230 0.57
231 0.6
232 0.66
233 0.71
234 0.72
235 0.75
236 0.7
237 0.65
238 0.6
239 0.62
240 0.57
241 0.51
242 0.42
243 0.36
244 0.35
245 0.32
246 0.31
247 0.29
248 0.27
249 0.23
250 0.24
251 0.22
252 0.22
253 0.29
254 0.28
255 0.29
256 0.3
257 0.3
258 0.3
259 0.3
260 0.28
261 0.27
262 0.33
263 0.38
264 0.45
265 0.53
266 0.54
267 0.58
268 0.58
269 0.53
270 0.48
271 0.5
272 0.52
273 0.53
274 0.55
275 0.58
276 0.58
277 0.57
278 0.62
279 0.58
280 0.57
281 0.6
282 0.66
283 0.63
284 0.69
285 0.73
286 0.71
287 0.67
288 0.63
289 0.58
290 0.54
291 0.55
292 0.52
293 0.56
294 0.6
295 0.64
296 0.68
297 0.68
298 0.69
299 0.71
300 0.75
301 0.72
302 0.65
303 0.61
304 0.54
305 0.5
306 0.44
307 0.39
308 0.3
309 0.28
310 0.3
311 0.33
312 0.33
313 0.35
314 0.39
315 0.45
316 0.55
317 0.61
318 0.64
319 0.65
320 0.7
321 0.74
322 0.78
323 0.78
324 0.78
325 0.79
326 0.81
327 0.84
328 0.86
329 0.85
330 0.82
331 0.8
332 0.76
333 0.73
334 0.71