Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136J776

Protein Details
Accession A0A136J776   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
83-113VGSHKAKKKASSAKKSRRKYRKLAEEGQEAEHydrophilic
NLS Segment(s)
PositionSequence
86-104HKAKKKASSAKKSRRKYRK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPQRPKPPPDDEFEENFLKGSGPGGQKINKTSSAVQLLHKPTGIVVKSQATRSRSQNRTIARQLLADKLDALANGDQSRAAIVGSHKAKKKASSAKKSRRKYRKLAEEGQEAEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.37
4 0.3
5 0.22
6 0.17
7 0.13
8 0.15
9 0.15
10 0.18
11 0.22
12 0.25
13 0.28
14 0.31
15 0.34
16 0.3
17 0.31
18 0.3
19 0.31
20 0.33
21 0.31
22 0.3
23 0.33
24 0.34
25 0.32
26 0.3
27 0.24
28 0.19
29 0.23
30 0.21
31 0.15
32 0.14
33 0.18
34 0.19
35 0.23
36 0.27
37 0.25
38 0.28
39 0.35
40 0.43
41 0.42
42 0.44
43 0.47
44 0.45
45 0.48
46 0.48
47 0.43
48 0.34
49 0.33
50 0.3
51 0.28
52 0.25
53 0.19
54 0.16
55 0.13
56 0.12
57 0.1
58 0.1
59 0.08
60 0.09
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.06
67 0.06
68 0.06
69 0.06
70 0.14
71 0.2
72 0.26
73 0.3
74 0.35
75 0.38
76 0.41
77 0.49
78 0.52
79 0.58
80 0.63
81 0.7
82 0.77
83 0.84
84 0.9
85 0.92
86 0.92
87 0.91
88 0.9
89 0.9
90 0.9
91 0.89
92 0.88
93 0.85
94 0.82
95 0.75