Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A459

Protein Details
Accession E5A459    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66WARSASRYRLWQRRKPPFFIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 6, extr 4, mito_nucl 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSVDEKRDYQMPTVDLCQCHGLMAFLWAASTFVLLIGLAHAQSTPLWARSASRYRLWQRRKPPFFIENQIAVSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.27
4 0.25
5 0.21
6 0.19
7 0.17
8 0.13
9 0.09
10 0.1
11 0.08
12 0.06
13 0.06
14 0.05
15 0.06
16 0.05
17 0.05
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.1
36 0.17
37 0.25
38 0.27
39 0.3
40 0.38
41 0.47
42 0.57
43 0.64
44 0.66
45 0.7
46 0.78
47 0.8
48 0.78
49 0.76
50 0.73
51 0.7
52 0.7
53 0.65
54 0.57