Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136J459

Protein Details
Accession A0A136J459    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
259-284EPVPAPKKVGRPKKDKTVEKKAAPAPBasic
NLS Segment(s)
PositionSequence
254-254K
257-287GEEPVPAPKKVGRPKKDKTVEKKAAPAPVRR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MADTTNTSSSNNNDMKPNTPPSTAAAENSTLASEGVPKPAGDASQTASGLPPITKEPMSIAGAPLVPVNPLTQTKVPTPPPEPATAPAAATQNAELTQASAPESGVKDKLDAADNLAQQPSKPEETAPSAVPASADATSSALEQPNLVATNGASQDAPKPVSVQEVQDEAAPAPAAAEKAPEPVTEKPAEAVAPEPSAQPAPAVAADPDTMDIDKPEAETGDKRKADESEVANGALPADKSQDGGDEPAGKKLKTNGEEPVPAPKKVGRPKKDKTVEKKAAPAPVRRTTRQTRSQGAPAGESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.43
4 0.48
5 0.43
6 0.4
7 0.39
8 0.36
9 0.4
10 0.38
11 0.33
12 0.28
13 0.25
14 0.24
15 0.23
16 0.2
17 0.14
18 0.13
19 0.11
20 0.13
21 0.13
22 0.15
23 0.16
24 0.15
25 0.17
26 0.18
27 0.18
28 0.15
29 0.15
30 0.15
31 0.18
32 0.19
33 0.17
34 0.16
35 0.17
36 0.16
37 0.15
38 0.13
39 0.11
40 0.15
41 0.15
42 0.15
43 0.16
44 0.19
45 0.22
46 0.21
47 0.19
48 0.17
49 0.17
50 0.17
51 0.15
52 0.11
53 0.08
54 0.08
55 0.08
56 0.09
57 0.11
58 0.14
59 0.16
60 0.19
61 0.22
62 0.29
63 0.32
64 0.34
65 0.36
66 0.38
67 0.38
68 0.39
69 0.37
70 0.32
71 0.32
72 0.27
73 0.25
74 0.21
75 0.2
76 0.17
77 0.16
78 0.14
79 0.11
80 0.11
81 0.11
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.08
89 0.09
90 0.11
91 0.11
92 0.12
93 0.12
94 0.12
95 0.12
96 0.14
97 0.14
98 0.13
99 0.15
100 0.18
101 0.18
102 0.19
103 0.19
104 0.17
105 0.15
106 0.18
107 0.17
108 0.14
109 0.14
110 0.13
111 0.15
112 0.2
113 0.22
114 0.19
115 0.18
116 0.16
117 0.16
118 0.15
119 0.12
120 0.09
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.07
127 0.08
128 0.07
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.06
135 0.05
136 0.05
137 0.07
138 0.07
139 0.08
140 0.07
141 0.06
142 0.09
143 0.1
144 0.11
145 0.09
146 0.1
147 0.09
148 0.13
149 0.13
150 0.12
151 0.12
152 0.12
153 0.13
154 0.12
155 0.12
156 0.09
157 0.09
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.08
167 0.09
168 0.09
169 0.12
170 0.14
171 0.18
172 0.18
173 0.18
174 0.16
175 0.16
176 0.15
177 0.12
178 0.12
179 0.09
180 0.09
181 0.09
182 0.09
183 0.09
184 0.1
185 0.09
186 0.08
187 0.07
188 0.06
189 0.06
190 0.07
191 0.06
192 0.07
193 0.07
194 0.07
195 0.08
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.07
202 0.08
203 0.07
204 0.07
205 0.09
206 0.14
207 0.19
208 0.27
209 0.28
210 0.28
211 0.3
212 0.31
213 0.33
214 0.34
215 0.32
216 0.28
217 0.28
218 0.28
219 0.25
220 0.24
221 0.2
222 0.16
223 0.13
224 0.08
225 0.1
226 0.1
227 0.1
228 0.1
229 0.12
230 0.11
231 0.13
232 0.15
233 0.19
234 0.19
235 0.26
236 0.29
237 0.27
238 0.28
239 0.33
240 0.4
241 0.36
242 0.39
243 0.37
244 0.4
245 0.44
246 0.42
247 0.47
248 0.42
249 0.39
250 0.39
251 0.37
252 0.41
253 0.48
254 0.58
255 0.56
256 0.63
257 0.71
258 0.79
259 0.85
260 0.86
261 0.85
262 0.86
263 0.86
264 0.81
265 0.82
266 0.76
267 0.75
268 0.7
269 0.69
270 0.66
271 0.66
272 0.68
273 0.64
274 0.68
275 0.69
276 0.73
277 0.74
278 0.74
279 0.72
280 0.71
281 0.74
282 0.72
283 0.64