Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A136IXP6

Protein Details
Accession A0A136IXP6   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28VPDARHARTVRTPKRQTRKLTTKEDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MAVPDARHARTVRTPKRQTRKLTTKEDANYQCEVPGCGKLFSRSYNYKAHMATHDENRDYPFPCLVPDCGKKFVRKTDLQRHNQSVHAKERSHRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.84
4 0.86
5 0.86
6 0.86
7 0.87
8 0.84
9 0.84
10 0.79
11 0.76
12 0.7
13 0.7
14 0.64
15 0.56
16 0.49
17 0.4
18 0.36
19 0.28
20 0.26
21 0.18
22 0.17
23 0.15
24 0.14
25 0.15
26 0.16
27 0.17
28 0.19
29 0.23
30 0.23
31 0.26
32 0.3
33 0.31
34 0.32
35 0.31
36 0.3
37 0.27
38 0.29
39 0.28
40 0.29
41 0.3
42 0.28
43 0.28
44 0.29
45 0.3
46 0.25
47 0.23
48 0.18
49 0.15
50 0.16
51 0.17
52 0.16
53 0.21
54 0.26
55 0.28
56 0.34
57 0.37
58 0.42
59 0.45
60 0.52
61 0.53
62 0.55
63 0.61
64 0.65
65 0.73
66 0.76
67 0.8
68 0.78
69 0.73
70 0.71
71 0.68
72 0.64
73 0.62
74 0.6
75 0.55